BLASTX nr result
ID: Mentha25_contig00011207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011207 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Mimulus... 69 9e-10 gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Mimulus... 65 1e-08 ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-l... 65 1e-08 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis] 64 2e-08 ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citr... 63 5e-08 ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-l... 63 5e-08 emb|CBI37146.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-l... 62 8e-08 ref|XP_002314488.2| alcohol oxidase-related family protein [Popu... 62 1e-07 ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-l... 61 1e-07 ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao] gi|5087024... 60 2e-07 ref|XP_002529832.1| electron carrier, putative [Ricinus communis... 60 3e-07 ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-l... 60 4e-07 ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prun... 59 5e-07 ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1-l... 59 7e-07 ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-l... 59 9e-07 ref|XP_006386919.1| hypothetical protein POPTR_0002s26130g [Popu... 59 9e-07 ref|XP_002311685.2| alcohol oxidase-related family protein [Popu... 57 2e-06 gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlise... 57 2e-06 ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phas... 57 3e-06 >gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Mimulus guttatus] Length = 744 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFL 338 DEVAE +VKR +P+ +F+VSL+L LSSR+GT LCG+IC D WPF+ Sbjct: 77 DEVAELIVKRGVPKAVFIVSLVLKFLSSRLGTLVLCGYICFDKNWPFV 124 >gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Mimulus guttatus] Length = 747 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 +E AE +VKR +P+ + VVSL+L LS+RIGT LCG CLD KWPF+H Sbjct: 73 NETAELIVKRGIPKAVLVVSLVLKFLSTRIGTLLLCGSNCLDWKWPFIH 121 >ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum] Length = 734 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/49 (51%), Positives = 39/49 (79%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 +EVAE +VKR+ P LF++ +++ LLS+R+G+ LCG +CLD +WPF+H Sbjct: 65 NEVAELLVKRSKPEALFIIRIVVFLLSTRLGSLLLCGRVCLDKRWPFVH 113 >gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis] Length = 743 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 DE AE +VK+ALP +VS +L +LS R+GT LCG+IC D KWPFLH Sbjct: 70 DETAEMVVKKALPPAASLVSWVLKILSFRLGTLLLCGFICFDWKWPFLH 118 >ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina] gi|568851625|ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis] gi|557546048|gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina] Length = 748 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +3 Query: 198 EVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 EVAE MVKR P+ +F+ L+L LLS R+GT LCG++C D WPF+H Sbjct: 73 EVAELMVKRGQPQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIH 120 >ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera] Length = 749 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFL 338 DE AE + KR LP G+ +VS++L +LS+R+GT LCG++CL KWPF+ Sbjct: 77 DEAAELLKKRGLPEGVMLVSIVLKILSTRLGTLLLCGFLCLGWKWPFI 124 >emb|CBI37146.3| unnamed protein product [Vitis vinifera] Length = 589 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFL 338 DE AE + KR LP G+ +VS++L +LS+R+GT LCG++CL KWPF+ Sbjct: 77 DEAAELLKKRGLPEGVMLVSIVLKILSTRLGTLLLCGFLCLGWKWPFI 124 >ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum] Length = 731 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/51 (45%), Positives = 40/51 (78%) Frame = +3 Query: 189 NSDEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 +++EVAE +VKR+ P L ++ +++ LL++R+G+ LCG +CLD +WPF+H Sbjct: 60 STNEVAELLVKRSKPEALLIIRIVVFLLTTRLGSLLLCGRVCLDKRWPFVH 110 >ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa] gi|550329337|gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa] Length = 743 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPF 335 DE+AE + KR LP +F+V L+L LLS+R+GTF LCG +C KWP+ Sbjct: 74 DEMAELLTKRGLPEAVFMVRLVLWLLSTRLGTFLLCGSLCFGEKWPY 120 >ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus] gi|449531315|ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus] Length = 738 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPF 335 DEVA+ +V+RA P+ +F+V L+L LLS RIGT LCG +C D +WPF Sbjct: 69 DEVADLLVERANPKAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPF 115 >ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao] gi|508702481|gb|EOX94377.1| Alcohol oxidase [Theobroma cacao] Length = 740 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/49 (51%), Positives = 34/49 (69%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 DEVA+ ++KR P+ + L+L L+S R+GT LCGW C D KWPF+H Sbjct: 73 DEVADFLMKRGQPKAVSFAKLVLTLVSFRLGTLLLCGWDCCDWKWPFIH 121 >ref|XP_002529832.1| electron carrier, putative [Ricinus communis] gi|223530660|gb|EEF32533.1| electron carrier, putative [Ricinus communis] Length = 745 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 DEVAE MV R L + VV +L +LS R+GT LCG+ICL+ WPF+H Sbjct: 76 DEVAELMVNRGLKEVVLVVDFLLKVLSFRLGTLLLCGFICLEWNWPFIH 124 >ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum] Length = 744 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/48 (50%), Positives = 38/48 (79%) Frame = +3 Query: 198 EVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 +VAE +V+RALP L ++ ++L +LS+R+GT LCG +CL+ KWPF++ Sbjct: 76 QVAEMLVERALPEALTLIRVILSMLSTRLGTLLLCGSLCLNKKWPFIN 123 >ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica] gi|462395894|gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica] Length = 754 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 DEVAE M+KRALP + + L L +LS R+GT LCG CL KWPF+H Sbjct: 81 DEVAELMLKRALPEVMEGMKLFLKMLSFRLGTLLLCGHRCLSWKWPFIH 129 >ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Fragaria vesca subsp. vesca] Length = 765 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 DEVA+ +VKRA + +V ++L +LS+R+G+ LCG +CL KWPF+H Sbjct: 83 DEVADLLVKRAFTEAIILVRVVLWILSTRLGSLLLCGSLCLGDKWPFIH 131 >ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine max] Length = 740 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = +3 Query: 198 EVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 E+AE ++KRAL L ++ ++L LLS+R+GT LCG +CL KWPF++ Sbjct: 68 EIAEILIKRALKEALILLRVILWLLSTRLGTLLLCGTLCLSKKWPFIN 115 >ref|XP_006386919.1| hypothetical protein POPTR_0002s26130g [Populus trichocarpa] gi|550345849|gb|ERP64716.1| hypothetical protein POPTR_0002s26130g [Populus trichocarpa] Length = 518 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +3 Query: 201 VAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 VAE MVK +P + V L+L LS R+GT LCG+ICLD KWP +H Sbjct: 76 VAELMVKSGVPEAVLFVRLVLKFLSCRLGTLLLCGFICLDWKWPLIH 122 >ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa] gi|550333249|gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa] Length = 744 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +3 Query: 195 DEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKW 329 DE+AE + KR LP +F+V L+L LLS+R+GTF LCG +C KW Sbjct: 75 DEIAELLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKW 119 >gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea] Length = 724 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +3 Query: 192 SDEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWP 332 S+EVAE +VKR +P+ +FVV L+L +LS+R+GT LCG+ CLD + P Sbjct: 58 SEEVAELLVKRGVPQAVFVVGLVLWVLSTRLGTLLLCGFTCLDWRSP 104 >ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris] gi|561036031|gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris] Length = 729 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = +3 Query: 192 SDEVAEEMVKRALPRGLFVVSLMLHLLSSRIGTFFLCGWICLDSKWPFLH 341 S E AE + KR +P L +V +L +LS R+GT +CG +CLD KWPF+H Sbjct: 66 SHEAAELLHKRVVPEALSLVGWVLWMLSFRLGTLLICGRLCLDWKWPFIH 115