BLASTX nr result
ID: Mentha25_contig00010143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00010143 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35501.1| hypothetical protein MIMGU_mgv1a0113001mg, partia... 57 2e-06 >gb|EYU35501.1| hypothetical protein MIMGU_mgv1a0113001mg, partial [Mimulus guttatus] Length = 146 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 1 EQVAQLKAPLDMRCKNNNRPCQPLNGRRVEVYGD 102 EQV LKAPLDMRCK N RPCQP+N R VEVY D Sbjct: 103 EQVQSLKAPLDMRCKYNARPCQPMNERHVEVYQD 136