BLASTX nr result
ID: Mentha25_contig00008954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00008954 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33662.1| hypothetical protein MIMGU_mgv1a006529mg [Mimulus... 57 4e-06 >gb|EYU33662.1| hypothetical protein MIMGU_mgv1a006529mg [Mimulus guttatus] Length = 440 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -3 Query: 380 SEERLEEVKELIFEAISCCIEGGAVGMTKAEESGSTHQPHEDADAIK 240 SEERLEEVKELIFEAI C +E G + EES + H+DADA+K Sbjct: 382 SEERLEEVKELIFEAICCNVEEGVLPPITVEESDDAAESHDDADALK 428