BLASTX nr result
ID: Mentha25_contig00008158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00008158 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31172.1| 39S ribosomal protein L47 [Morus notabilis] 86 4e-15 ref|NP_001241009.1| uncharacterized protein LOC100812176 [Glycin... 86 4e-15 ref|NP_001238505.1| uncharacterized protein LOC100500208 [Glycin... 86 4e-15 ref|XP_007138200.1| hypothetical protein PHAVU_009G188900g [Phas... 86 5e-15 ref|XP_004138121.1| PREDICTED: 39S ribosomal protein L47, mitoch... 85 9e-15 ref|XP_006655739.1| PREDICTED: 39S ribosomal protein L47, mitoch... 85 1e-14 ref|XP_004964406.1| PREDICTED: 39S ribosomal protein L47, mitoch... 85 1e-14 ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitoch... 85 1e-14 ref|NP_001056673.1| Os06g0128500 [Oryza sativa Japonica Group] g... 84 2e-14 gb|EEC79917.1| hypothetical protein OsI_21467 [Oryza sativa Indi... 84 2e-14 gb|EYU29929.1| hypothetical protein MIMGU_mgv1a015895mg [Mimulus... 84 2e-14 ref|XP_006417761.1| hypothetical protein EUTSA_v10009035mg [Eutr... 84 3e-14 ref|XP_006292012.1| hypothetical protein CARUB_v10018201mg [Caps... 84 3e-14 ref|XP_002889667.1| ribosomal protein L29 family protein [Arabid... 84 3e-14 ref|XP_002436394.1| hypothetical protein SORBIDRAFT_10g001740 [S... 84 3e-14 gb|ACL54048.1| unknown [Zea mays] gi|413953417|gb|AFW86066.1| 39... 84 3e-14 gb|ACG35150.1| 39S ribosomal protein L47 [Zea mays] 84 3e-14 ref|NP_001147665.1| 39S ribosomal protein L47 [Zea mays] gi|1956... 84 3e-14 ref|XP_006439758.1| hypothetical protein CICLE_v10022742mg [Citr... 83 4e-14 ref|XP_006476735.1| PREDICTED: 39S ribosomal protein L47, mitoch... 83 5e-14 >gb|EXC31172.1| 39S ribosomal protein L47 [Morus notabilis] Length = 143 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FPSPERI KVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN L Sbjct: 100 FPSPERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINVL 143 >ref|NP_001241009.1| uncharacterized protein LOC100812176 [Glycine max] gi|255640572|gb|ACU20571.1| unknown [Glycine max] Length = 143 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN+L Sbjct: 100 FPNPERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINAL 143 >ref|NP_001238505.1| uncharacterized protein LOC100500208 [Glycine max] gi|255629706|gb|ACU15202.1| unknown [Glycine max] Length = 142 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMIN+L Sbjct: 99 FPNPERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINAL 142 >ref|XP_007138200.1| hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] gi|561011287|gb|ESW10194.1| hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] Length = 142 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKVRKSMCRIKHVLTERAIEEPDPRRSA+MK+MIN+L Sbjct: 99 FPNPERISKVRKSMCRIKHVLTERAIEEPDPRRSADMKKMINAL 142 >ref|XP_004138121.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cucumis sativus] gi|449528917|ref|XP_004171448.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cucumis sativus] Length = 143 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVRKSMCRIKHVLTERAI+EPDPRRSAEMKRMIN+L Sbjct: 100 FPNPERIPKVRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 143 >ref|XP_006655739.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Oryza brachyantha] Length = 147 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMIN+L Sbjct: 104 FPNPERISKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINTL 147 >ref|XP_004964406.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Setaria italica] Length = 145 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMIN+L Sbjct: 102 FPNPERISKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINTL 145 >ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 1 [Vitis vinifera] gi|225457112|ref|XP_002283459.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 2 [Vitis vinifera] gi|297733826|emb|CBI15073.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVRKSMCRIKHVLTERAIEEPDPRRS EMKRMIN+L Sbjct: 97 FPNPERIPKVRKSMCRIKHVLTERAIEEPDPRRSVEMKRMINAL 140 >ref|NP_001056673.1| Os06g0128500 [Oryza sativa Japonica Group] gi|52075615|dbj|BAD44786.1| ribosomal protein L29 protein-like [Oryza sativa Japonica Group] gi|113594713|dbj|BAF18587.1| Os06g0128500 [Oryza sativa Japonica Group] gi|215765035|dbj|BAG86732.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768582|dbj|BAH00811.1| unnamed protein product [Oryza sativa Japonica Group] Length = 145 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PER+SKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMIN+L Sbjct: 102 FPNPERVSKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINAL 145 >gb|EEC79917.1| hypothetical protein OsI_21467 [Oryza sativa Indica Group] gi|222634889|gb|EEE65021.1| hypothetical protein OsJ_19975 [Oryza sativa Japonica Group] Length = 291 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PER+SKV+KSMCRIKHVLTERAI EPDPRRSAEMKRMIN+L Sbjct: 248 FPNPERVSKVKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINAL 291 >gb|EYU29929.1| hypothetical protein MIMGU_mgv1a015895mg [Mimulus guttatus] gi|604318420|gb|EYU29930.1| hypothetical protein MIMGU_mgv1a015895mg [Mimulus guttatus] Length = 141 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PER+ KVRKSMCRIKHVLTERAIEE DPRRSAEMKRMINSL Sbjct: 98 FPNPERVPKVRKSMCRIKHVLTERAIEEQDPRRSAEMKRMINSL 141 >ref|XP_006417761.1| hypothetical protein EUTSA_v10009035mg [Eutrema salsugineum] gi|557095532|gb|ESQ36114.1| hypothetical protein EUTSA_v10009035mg [Eutrema salsugineum] Length = 144 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVR+SMCRIKHVLTERAIEEPDPRRSAEMKRM+N + Sbjct: 101 FPNPERIPKVRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVNGM 144 >ref|XP_006292012.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|565468266|ref|XP_006292013.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|482560719|gb|EOA24910.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|482560720|gb|EOA24911.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] Length = 144 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVR+SMCRIKHVLTERAIEEPDPRRSAEMKRM+N + Sbjct: 101 FPNPERIPKVRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVNGM 144 >ref|XP_002889667.1| ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335509|gb|EFH65926.1| ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] Length = 143 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVR+SMCRIKHVLTERAIEEPDPRRSAEMKRM+N + Sbjct: 100 FPNPERIPKVRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVNGM 143 >ref|XP_002436394.1| hypothetical protein SORBIDRAFT_10g001740 [Sorghum bicolor] gi|241914617|gb|EER87761.1| hypothetical protein SORBIDRAFT_10g001740 [Sorghum bicolor] Length = 146 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMIN+L Sbjct: 103 FPNPERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINAL 146 >gb|ACL54048.1| unknown [Zea mays] gi|413953417|gb|AFW86066.1| 39S ribosomal protein L47 isoform 1 [Zea mays] gi|413953418|gb|AFW86067.1| 39S ribosomal protein L47 isoform 2 [Zea mays] Length = 138 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMIN+L Sbjct: 95 FPNPERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINAL 138 >gb|ACG35150.1| 39S ribosomal protein L47 [Zea mays] Length = 138 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMIN+L Sbjct: 95 FPNPERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINAL 138 >ref|NP_001147665.1| 39S ribosomal protein L47 [Zea mays] gi|195612940|gb|ACG28300.1| 39S ribosomal protein L47 [Zea mays] Length = 138 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERISKV+KSMCRIKHVLTERAI EPDPRRS+EMKRMIN+L Sbjct: 95 FPNPERISKVKKSMCRIKHVLTERAIAEPDPRRSSEMKRMINAL 138 >ref|XP_006439758.1| hypothetical protein CICLE_v10022742mg [Citrus clementina] gi|557542020|gb|ESR52998.1| hypothetical protein CICLE_v10022742mg [Citrus clementina] Length = 143 Score = 83.2 bits (204), Expect = 4e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PERI KVRKSMCRIK VLTERAIEEPDPRRSAEMKRMIN+L Sbjct: 100 FPNPERIPKVRKSMCRIKQVLTERAIEEPDPRRSAEMKRMINAL 143 >ref|XP_006476735.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Citrus sinensis] Length = 143 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 321 FPSPERISKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINSL 190 FP+PER+ KVRKSMCRIK VLTERAIEEPDPRRSAEMKRMIN+L Sbjct: 100 FPNPERVPKVRKSMCRIKQVLTERAIEEPDPRRSAEMKRMINAL 143