BLASTX nr result
ID: Mentha25_contig00007842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00007842 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38702.1| hypothetical protein MIMGU_mgv1a001826mg [Mimulus... 57 4e-06 >gb|EYU38702.1| hypothetical protein MIMGU_mgv1a001826mg [Mimulus guttatus] Length = 754 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 325 YKEVGALVAMVVGYRILAYLSLRRMKLQPGA 233 Y EVG L AMVVGYR+LAYLSLRRMKLQPGA Sbjct: 724 YTEVGVLAAMVVGYRLLAYLSLRRMKLQPGA 754