BLASTX nr result
ID: Mentha25_contig00007593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00007593 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB39373.1| hypothetical protein L484_025068 [Morus notabilis] 70 2e-10 ref|XP_003518924.1| PREDICTED: chloroplast stem-loop binding pro... 70 2e-10 gb|ACU24035.1| unknown [Glycine max] 70 2e-10 ref|XP_003590650.1| MRNA-binding protein [Medicago truncatula] g... 70 4e-10 ref|XP_003590649.1| MRNA-binding protein [Medicago truncatula] g... 70 4e-10 gb|ADQ57386.1| CSP41A-X protein [Silene latifolia] 70 4e-10 ref|XP_007144635.1| hypothetical protein PHAVU_007G172100g [Phas... 69 5e-10 gb|ADQ57387.1| CSP41A-Y protein [Silene latifolia] 69 5e-10 ref|XP_003536518.1| PREDICTED: chloroplast stem-loop binding pro... 69 7e-10 ref|XP_006349675.1| PREDICTED: chloroplast stem-loop binding pro... 69 9e-10 ref|NP_001234656.1| mRNA binding protein precursor [Solanum lyco... 69 9e-10 ref|XP_004495202.1| PREDICTED: chloroplast stem-loop binding pro... 68 1e-09 gb|ADQ57385.1| CSP41A protein [Silene vulgaris] 68 1e-09 ref|NP_191873.1| chloroplast stem-loop binding protein-41 [Arabi... 68 2e-09 ref|XP_002878498.1| hypothetical protein ARALYDRAFT_486816 [Arab... 68 2e-09 gb|ABK42080.1| mRNA-binding protein [Capsicum annuum] 67 3e-09 gb|AAP87140.1| mRNA-binding protein precursor, partial [Nicotian... 67 3e-09 ref|XP_006402306.1| hypothetical protein EUTSA_v10006498mg [Eutr... 67 3e-09 ref|XP_006291238.1| hypothetical protein CARUB_v10017370mg [Caps... 67 3e-09 gb|AAC49424.1| chloroplast mRNA-binding protein CSP41 precursor,... 67 3e-09 >gb|EXB39373.1| hypothetical protein L484_025068 [Morus notabilis] Length = 408 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE +EEYVKIGRDKKDIKFELDDKI+ ALKVPV Sbjct: 369 LPEDLKERFEEYVKIGRDKKDIKFELDDKILDALKVPV 406 >ref|XP_003518924.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Glycine max] Length = 403 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEYVKIGRDKK I+FELDDKI+ ALKVPVTV Sbjct: 364 LPEDLKERFEEYVKIGRDKKSIQFELDDKILEALKVPVTV 403 >gb|ACU24035.1| unknown [Glycine max] Length = 403 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEYVKIGRDKK I+FELDDKI+ ALKVPVTV Sbjct: 364 LPEDLKERFEEYVKIGRDKKSIQFELDDKILEALKVPVTV 403 >ref|XP_003590650.1| MRNA-binding protein [Medicago truncatula] gi|355479698|gb|AES60901.1| MRNA-binding protein [Medicago truncatula] Length = 419 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEY+KIGRDKK IKFELDDKI+ ALKVPV+V Sbjct: 380 LPEDLKERFEEYIKIGRDKKPIKFELDDKILEALKVPVSV 419 >ref|XP_003590649.1| MRNA-binding protein [Medicago truncatula] gi|355479697|gb|AES60900.1| MRNA-binding protein [Medicago truncatula] Length = 401 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEY+KIGRDKK IKFELDDKI+ ALKVPV+V Sbjct: 362 LPEDLKERFEEYIKIGRDKKPIKFELDDKILEALKVPVSV 401 >gb|ADQ57386.1| CSP41A-X protein [Silene latifolia] Length = 306 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LP+DLKE YEEYVKIGRDKKDIKFELDDKI+ ALK P V Sbjct: 267 LPDDLKERYEEYVKIGRDKKDIKFELDDKILEALKAPAAV 306 >ref|XP_007144635.1| hypothetical protein PHAVU_007G172100g [Phaseolus vulgaris] gi|561017825|gb|ESW16629.1| hypothetical protein PHAVU_007G172100g [Phaseolus vulgaris] Length = 402 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEYVKIGRDKK IKFE+DDKI+ ALKVPV+V Sbjct: 363 LPEDLKERFEEYVKIGRDKKSIKFEVDDKILEALKVPVSV 402 >gb|ADQ57387.1| CSP41A-Y protein [Silene latifolia] Length = 306 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LP+DLKE YEEYVKIGRDKKDIKFELDDKI+ ALK P V Sbjct: 267 LPDDLKERYEEYVKIGRDKKDIKFELDDKILDALKAPAAV 306 >ref|XP_003536518.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Glycine max] Length = 404 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEYVKIGRDKK I+FELDDKI+ ALKVPV+V Sbjct: 365 LPEDLKERFEEYVKIGRDKKSIQFELDDKILEALKVPVSV 404 >ref|XP_006349675.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Solanum tuberosum] Length = 401 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE YEEYVKIGRDKK++KFELDDKI+ +LKVPV Sbjct: 362 LPEDLKERYEEYVKIGRDKKEMKFELDDKILESLKVPV 399 >ref|NP_001234656.1| mRNA binding protein precursor [Solanum lycopersicum] gi|26453355|gb|AAD21574.3| mRNA binding protein precursor [Solanum lycopersicum] Length = 407 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE YEEYVKIGRDKK++KFELDDKI+ +LKVPV Sbjct: 368 LPEDLKERYEEYVKIGRDKKEMKFELDDKILESLKVPV 405 >ref|XP_004495202.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa a, chloroplastic-like [Cicer arietinum] Length = 403 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LPEDLKE +EEY+KIGRDKK IKFE+DDKI+ ALKVPV V Sbjct: 364 LPEDLKERFEEYIKIGRDKKPIKFEVDDKILEALKVPVAV 403 >gb|ADQ57385.1| CSP41A protein [Silene vulgaris] Length = 306 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPVTV 121 LP+DLKE Y+EYVKIGRDKKDIKFELDDKI+ ALK P V Sbjct: 267 LPDDLKERYDEYVKIGRDKKDIKFELDDKILDALKAPAAV 306 >ref|NP_191873.1| chloroplast stem-loop binding protein-41 [Arabidopsis thaliana] gi|75311698|sp|Q9LYA9.1|CP41A_ARATH RecName: Full=Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic; Short=CSP41-a; Flags: Precursor gi|16226201|gb|AAL16101.1|AF428269_1 AT3g63140/T20O10_240 [Arabidopsis thaliana] gi|7573443|emb|CAB87759.1| mRNA binding protein precursor-like [Arabidopsis thaliana] gi|16649035|gb|AAL24369.1| mRNA binding protein precursor-like [Arabidopsis thaliana] gi|22136252|gb|AAM91204.1| mRNA binding protein precursor-like [Arabidopsis thaliana] gi|332646919|gb|AEE80440.1| chloroplast stem-loop binding protein-41 [Arabidopsis thaliana] Length = 406 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE +EEYVKIGRDKK+IKFELDDKI+ ALK PV Sbjct: 367 LPEDLKERFEEYVKIGRDKKEIKFELDDKILEALKTPV 404 >ref|XP_002878498.1| hypothetical protein ARALYDRAFT_486816 [Arabidopsis lyrata subsp. lyrata] gi|297324336|gb|EFH54757.1| hypothetical protein ARALYDRAFT_486816 [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE +EEYVKIGRDKK+IKFELDDKI+ ALK PV Sbjct: 369 LPEDLKERFEEYVKIGRDKKEIKFELDDKILEALKTPV 406 >gb|ABK42080.1| mRNA-binding protein [Capsicum annuum] Length = 169 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE +EEYVKIGRDKK++KFELDDKI+ +LKVPV Sbjct: 130 LPEDLKERFEEYVKIGRDKKEMKFELDDKILESLKVPV 167 >gb|AAP87140.1| mRNA-binding protein precursor, partial [Nicotiana tabacum] Length = 405 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE ++EYVKIGRDKK++KFELDDKI+ ALKVPV Sbjct: 366 LPEDLKERFDEYVKIGRDKKEMKFELDDKILEALKVPV 403 >ref|XP_006402306.1| hypothetical protein EUTSA_v10006498mg [Eutrema salsugineum] gi|557103405|gb|ESQ43759.1| hypothetical protein EUTSA_v10006498mg [Eutrema salsugineum] Length = 402 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE +EEYVKIGRDKK++KFELDDKI+ ALK PV Sbjct: 363 LPEDLKERFEEYVKIGRDKKEMKFELDDKILQALKTPV 400 >ref|XP_006291238.1| hypothetical protein CARUB_v10017370mg [Capsella rubella] gi|482559945|gb|EOA24136.1| hypothetical protein CARUB_v10017370mg [Capsella rubella] Length = 404 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE +EEYVKIGRDKK++KFELDDKI+ ALK PV Sbjct: 365 LPEDLKERFEEYVKIGRDKKEMKFELDDKILEALKAPV 402 >gb|AAC49424.1| chloroplast mRNA-binding protein CSP41 precursor, partial [Spinacia oleracea] Length = 415 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 2 LPEDLKE*YEEYVKIGRDKKDIKFELDDKIIAALKVPV 115 LPEDLKE YEEYVKIGRDKKDIKFE+DDKI+ AL V V Sbjct: 377 LPEDLKERYEEYVKIGRDKKDIKFEIDDKILEALNVSV 414