BLASTX nr result
ID: Mentha25_contig00006973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006973 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34027.1| hypothetical protein MIMGU_mgv1a024943mg, partial... 71 2e-10 gb|AGE15495.1| preprosilpepsin 2 [Silybum marianum] 69 5e-10 ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus ... 69 7e-10 ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citr... 69 7e-10 ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [A... 69 7e-10 gb|EPS68187.1| aspartic protease, partial [Genlisea aurea] 69 7e-10 gb|EYU19381.1| hypothetical protein MIMGU_mgv1a004925mg [Mimulus... 69 9e-10 pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen... 69 9e-10 sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=As... 69 9e-10 gb|EXB66327.1| Aspartic proteinase [Morus notabilis] 68 1e-09 gb|EMT17680.1| Phytepsin [Aegilops tauschii] 68 1e-09 gb|AAB03843.2| aspartic proteinase [Vigna unguiculata] gi|333397... 68 1e-09 dbj|BAE20413.1| aspartic proteinase [Triticum aestivum] 68 1e-09 ref|XP_003567869.1| PREDICTED: phytepsin-like [Brachypodium dist... 68 1e-09 ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ric... 68 1e-09 dbj|BAG16519.1| putative aspartic protease [Capsicum chinense] 68 1e-09 ref|XP_003632941.1| PREDICTED: aspartic proteinase isoform 2 [Vi... 68 1e-09 emb|CBI23210.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|NP_001043786.1| Os01g0663400 [Oryza sativa Japonica Group] g... 68 1e-09 ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-li... 67 2e-09 >gb|EYU34027.1| hypothetical protein MIMGU_mgv1a024943mg, partial [Mimulus guttatus] Length = 382 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYGNL++GFAEAA Sbjct: 351 RGPLWILGDVFMGPYHTVFDYGNLKVGFAEAA 382 >gb|AGE15495.1| preprosilpepsin 2 [Silybum marianum] Length = 509 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGD+FMGPYHTVFDYG LR+GFAEAA Sbjct: 478 RGPLWILGDIFMGPYHTVFDYGKLRVGFAEAA 509 >ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus sinensis] Length = 514 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDY N+R+GFAEAA Sbjct: 483 RGPLWILGDVFMGPYHTVFDYSNMRVGFAEAA 514 >ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citrus clementina] gi|557555641|gb|ESR65655.1| hypothetical protein CICLE_v10008027mg [Citrus clementina] Length = 514 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDY N+R+GFAEAA Sbjct: 483 RGPLWILGDVFMGPYHTVFDYSNMRVGFAEAA 514 >ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda] gi|548842083|gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda] Length = 510 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGNLR+GFAEAA Sbjct: 479 RGPLWILGDVFMGAYHTVFDYGNLRVGFAEAA 510 >gb|EPS68187.1| aspartic protease, partial [Genlisea aurea] Length = 500 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGNLRLGFAE+A Sbjct: 469 RGPLWILGDVFMGAYHTVFDYGNLRLGFAESA 500 >gb|EYU19381.1| hypothetical protein MIMGU_mgv1a004925mg [Mimulus guttatus] gi|604299487|gb|EYU19382.1| hypothetical protein MIMGU_mgv1a004925mg [Mimulus guttatus] Length = 504 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGNL+LGFAEAA Sbjct: 473 RGPLWILGDVFMGAYHTVFDYGNLQLGFAEAA 504 >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. gi|5822249|pdb|1QDM|B Chain B, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. gi|5822250|pdb|1QDM|C Chain C, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase Length = 478 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYG LR+GFA+AA Sbjct: 447 RGPLWILGDVFMGPYHTVFDYGKLRIGFAKAA 478 >sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=Aspartic proteinase; Contains: RecName: Full=Phytepsin 32 kDa subunit; Contains: RecName: Full=Phytepsin 29 kDa subunit; Contains: RecName: Full=Phytepsin 16 kDa subunit; Contains: RecName: Full=Phytepsin 11 kDa subunit; Flags: Precursor gi|18904|emb|CAA39602.1| aspartic proteinase [Hordeum vulgare subsp. vulgare] Length = 508 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYG LR+GFA+AA Sbjct: 477 RGPLWILGDVFMGPYHTVFDYGKLRIGFAKAA 508 >gb|EXB66327.1| Aspartic proteinase [Morus notabilis] Length = 514 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGN+R+GFAEAA Sbjct: 483 RGPLWILGDVFMGRYHTVFDYGNMRIGFAEAA 514 >gb|EMT17680.1| Phytepsin [Aegilops tauschii] Length = 446 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYG LR+GFA+AA Sbjct: 415 RGPLWILGDVFMGPYHTVFDYGKLRVGFAKAA 446 >gb|AAB03843.2| aspartic proteinase [Vigna unguiculata] gi|33339734|gb|AAQ14346.1| aspartic proteinase [Vigna unguiculata] Length = 513 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFD+GN R+GFAEAA Sbjct: 482 RGPLWILGDVFMGPYHTVFDFGNQRVGFAEAA 513 >dbj|BAE20413.1| aspartic proteinase [Triticum aestivum] Length = 508 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYG LR+GFA+AA Sbjct: 477 RGPLWILGDVFMGPYHTVFDYGKLRVGFAKAA 508 >ref|XP_003567869.1| PREDICTED: phytepsin-like [Brachypodium distachyon] Length = 505 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYG LR+GFA+AA Sbjct: 474 RGPLWILGDVFMGPYHTVFDYGKLRVGFAKAA 505 >ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis] gi|223542290|gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis] Length = 511 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGD+FMG YHTVFDYGNLR+GFAEAA Sbjct: 480 RGPLWILGDIFMGRYHTVFDYGNLRVGFAEAA 511 >dbj|BAG16519.1| putative aspartic protease [Capsicum chinense] Length = 506 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMGPYHTVFDYGN ++GFAEAA Sbjct: 475 RGPLWILGDVFMGPYHTVFDYGNSQVGFAEAA 506 >ref|XP_003632941.1| PREDICTED: aspartic proteinase isoform 2 [Vitis vinifera] gi|359483347|ref|XP_002262915.2| PREDICTED: aspartic proteinase isoform 1 [Vitis vinifera] Length = 514 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGN+R+GFAEAA Sbjct: 483 RGPLWILGDVFMGRYHTVFDYGNMRVGFAEAA 514 >emb|CBI23210.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGN+R+GFAEAA Sbjct: 398 RGPLWILGDVFMGRYHTVFDYGNMRVGFAEAA 429 >ref|NP_001043786.1| Os01g0663400 [Oryza sativa Japonica Group] gi|113533317|dbj|BAF05700.1| Os01g0663400 [Oryza sativa Japonica Group] gi|215701483|dbj|BAG92907.1| unnamed protein product [Oryza sativa Japonica Group] gi|218188796|gb|EEC71223.1| hypothetical protein OsI_03158 [Oryza sativa Indica Group] gi|222618996|gb|EEE55128.1| hypothetical protein OsJ_02912 [Oryza sativa Japonica Group] gi|385717674|gb|AFI71272.1| unnamed protein [Oryza sativa Japonica Group] Length = 522 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGDVFMG YHTVFDYGNL++GFAEAA Sbjct: 491 RGPLWILGDVFMGAYHTVFDYGNLKVGFAEAA 522 >ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica] Length = 507 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 349 RGPLWILGDVFMGPYHTVFDYGNLRLGFAEAA 254 RGPLWILGD+FMG YHTVFDYGNL++GFAEAA Sbjct: 476 RGPLWILGDIFMGAYHTVFDYGNLKVGFAEAA 507