BLASTX nr result
ID: Mentha25_contig00006889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006889 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002438210.1| hypothetical protein SORBIDRAFT_10g009598 [S... 59 9e-07 ref|XP_002446095.1| hypothetical protein SORBIDRAFT_06g001660 [S... 58 2e-06 gb|ABF70031.1| DNA helicase homolog, putative [Musa acuminata] 57 3e-06 ref|XP_002445319.1| hypothetical protein SORBIDRAFT_07g009320 [S... 56 5e-06 ref|XP_002453068.1| hypothetical protein SORBIDRAFT_04g037770 [S... 56 5e-06 >ref|XP_002438210.1| hypothetical protein SORBIDRAFT_10g009598 [Sorghum bicolor] gi|241916433|gb|EER89577.1| hypothetical protein SORBIDRAFT_10g009598 [Sorghum bicolor] Length = 521 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = -3 Query: 157 TETWRLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQLPKMPDELWNLYA 8 T+T L P C +C A RF +E PGFCC SGK+E+ P +PDEL L++ Sbjct: 247 TDTHMLKPVTNCNHCDAKRFEHESPGFCCRSGKVELNDPNVPDELMRLWS 296 >ref|XP_002446095.1| hypothetical protein SORBIDRAFT_06g001660 [Sorghum bicolor] gi|241937278|gb|EES10423.1| hypothetical protein SORBIDRAFT_06g001660 [Sorghum bicolor] Length = 1484 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = -3 Query: 154 ETWRLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQLPKMPDELWNLY 11 ET L P C +C A RF EPPGFCC SGK+E+ P +P++L L+ Sbjct: 63 ETHMLKPVPDCKHCGAKRFPKEPPGFCCRSGKVELNAPVIPNQLMRLW 110 >gb|ABF70031.1| DNA helicase homolog, putative [Musa acuminata] Length = 1605 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = -3 Query: 157 TETWRLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQLPKMPDELWNLYA 8 TET +L C +C A RF EPPGFCC SGK+E+ P +P +L L++ Sbjct: 223 TETHKLKSVPNCHHCGAKRFPKEPPGFCCRSGKVELNAPVIPSQLMRLWS 272 >ref|XP_002445319.1| hypothetical protein SORBIDRAFT_07g009320 [Sorghum bicolor] gi|241941669|gb|EES14814.1| hypothetical protein SORBIDRAFT_07g009320 [Sorghum bicolor] Length = 1342 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = -3 Query: 154 ETWRLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQLPKMPDELWNLY 11 ET L P C +C A RF EPPGFCC +GK+E+ P +P++L L+ Sbjct: 256 ETHMLKPVPDCHHCGAKRFPKEPPGFCCRNGKVELNAPVVPNQLMRLW 303 >ref|XP_002453068.1| hypothetical protein SORBIDRAFT_04g037770 [Sorghum bicolor] gi|241932899|gb|EES06044.1| hypothetical protein SORBIDRAFT_04g037770 [Sorghum bicolor] Length = 1275 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = -3 Query: 154 ETWRLPPKDPCPYCKAIRFANEPPGFCCASGKIEIQLPKMPDELWNLY 11 ET L P C +C RF EPPGFCC SGK+E+ P +P++L L+ Sbjct: 261 ETHMLKPVPDCKHCGVKRFPKEPPGFCCRSGKVELHAPVIPNQLMRLW 308