BLASTX nr result
ID: Mentha25_contig00006645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006645 (821 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30282.1| hypothetical protein MIMGU_mgv1a004150mg [Mimulus... 72 8e-13 >gb|EYU30282.1| hypothetical protein MIMGU_mgv1a004150mg [Mimulus guttatus] Length = 541 Score = 71.6 bits (174), Expect(2) = 8e-13 Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 4/117 (3%) Frame = -2 Query: 763 WKDYDERFLGKDPLSKDLLRDKLVEQLSQQPESTDGAQPGVDCRGEDFGSQGKSEAKGTR 584 WK+Y E F+ K+ ++ + + S Q + + QP VD +D GSQ K++ K R Sbjct: 199 WKEYVENFMAKESSRNEVSGFNISKVQSPQSRTMEAEQPRVDNLEKDLGSQDKTDVKRQR 258 Query: 583 KSNQTKSLAIALPQRR----SVSGFQKESHGVGTSVEDGIAPELPVNCPENKVKSLS 425 K+ + S A++ ++ S S +K+S+ VG +VED ++PVNC NK+KSL+ Sbjct: 259 KNKKKSSSAVSPTKKSNSVISCSTVEKDSYSVGPTVEDLSNLDMPVNCETNKMKSLN 315 Score = 28.9 bits (63), Expect(2) = 8e-13 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 819 RTLENGFLSAVFIYFNFG 766 RTLENGF S VF +F FG Sbjct: 177 RTLENGFPSDVFDHFRFG 194