BLASTX nr result
ID: Mentha25_contig00006597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006597 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 107 1e-21 ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19, chloro... 107 1e-21 ref|XP_006368958.1| ribosomal protein L19 [Populus trichocarpa] ... 107 2e-21 gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus... 107 2e-21 ref|XP_007039708.1| Ribosomal protein L19 family protein [Theobr... 106 3e-21 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloro... 106 4e-21 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 106 4e-21 dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] 105 5e-21 ref|XP_006414215.1| hypothetical protein EUTSA_v10026152mg [Eutr... 105 5e-21 ref|XP_006398416.1| hypothetical protein EUTSA_v10001011mg [Eutr... 105 5e-21 ref|XP_006284481.1| hypothetical protein CARUB_v10005667mg [Caps... 105 5e-21 ref|XP_006281041.1| hypothetical protein CARUB_v10027056mg [Caps... 105 5e-21 gb|ABD65070.1| plastid ribosomal protein L19, putative [Brassica... 105 5e-21 ref|XP_002870097.1| ribosomal protein L19 family protein [Arabid... 105 5e-21 ref|XP_002863352.1| hypothetical protein ARALYDRAFT_494259 [Arab... 105 5e-21 gb|ACF23041.1| ST10 [Eutrema halophilum] 105 5e-21 gb|AAM64533.1| contains similarity to plastid ribosomal protein ... 105 5e-21 ref|NP_568677.1| 50S ribosomal protein L19-2 [Arabidopsis thalia... 105 5e-21 ref|NP_567531.1| 50S ribosomal protein L19-1 [Arabidopsis thalia... 105 5e-21 gb|EXC02074.1| 50S ribosomal protein L19-1 [Morus notabilis] 105 8e-21 >ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Solanum tuberosum] Length = 222 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAGVGVEIVFPVYSPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 168 TTIRIRRIIAGVGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 222 >ref|XP_004245816.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Solanum lycopersicum] Length = 214 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAGVGVEIVFPVYSPNIKE+KV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 160 TTIRIRRIIAGVGVEIVFPVYSPNIKELKVVKHRKVRRARLYYLRDKLPRLSTFK 214 >ref|XP_006368958.1| ribosomal protein L19 [Populus trichocarpa] gi|118483873|gb|ABK93827.1| unknown [Populus trichocarpa] gi|550347317|gb|ERP65527.1| ribosomal protein L19 [Populus trichocarpa] Length = 241 Score = 107 bits (267), Expect = 2e-21 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+KHRKVRRARLYYLRDKLPRLSTFK Sbjct: 187 TTIRIRRIIAGIGVEIVFPLYSPNIKEIKVIKHRKVRRARLYYLRDKLPRLSTFK 241 >gb|EYU19455.1| hypothetical protein MIMGU_mgv1a013552mg [Mimulus guttatus] Length = 217 Score = 107 bits (266), Expect = 2e-21 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRRVIAGVGVEIVFPVYSPNIKEI+VL HRKVRRARLYYLRDKLPRLSTFK Sbjct: 163 TTIRIRRVIAGVGVEIVFPVYSPNIKEIRVLSHRKVRRARLYYLRDKLPRLSTFK 217 >ref|XP_007039708.1| Ribosomal protein L19 family protein [Theobroma cacao] gi|508776953|gb|EOY24209.1| Ribosomal protein L19 family protein [Theobroma cacao] Length = 242 Score = 106 bits (265), Expect = 3e-21 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFPVYSPNIKEIKV+KHRKVRRARLYYLR+KLPRLSTFK Sbjct: 188 TTIRIRRIIAGIGVEIVFPVYSPNIKEIKVVKHRKVRRARLYYLREKLPRLSTFK 242 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 106 bits (264), Expect = 4e-21 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIR+RR+IAGVGVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 177 TTIRVRRIIAGVGVEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 106 bits (264), Expect = 4e-21 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIR+RR+IAGVGVEIVFPVYSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 177 TTIRVRRIIAGVGVEIVFPVYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 231 >dbj|BAA97152.1| unnamed protein product [Arabidopsis thaliana] Length = 286 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 232 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 286 >ref|XP_006414215.1| hypothetical protein EUTSA_v10026152mg [Eutrema salsugineum] gi|557115385|gb|ESQ55668.1| hypothetical protein EUTSA_v10026152mg [Eutrema salsugineum] Length = 229 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 175 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|XP_006398416.1| hypothetical protein EUTSA_v10001011mg [Eutrema salsugineum] gi|557099505|gb|ESQ39869.1| hypothetical protein EUTSA_v10001011mg [Eutrema salsugineum] Length = 226 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 172 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 226 >ref|XP_006284481.1| hypothetical protein CARUB_v10005667mg [Capsella rubella] gi|482553186|gb|EOA17379.1| hypothetical protein CARUB_v10005667mg [Capsella rubella] Length = 227 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 173 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 227 >ref|XP_006281041.1| hypothetical protein CARUB_v10027056mg [Capsella rubella] gi|482549745|gb|EOA13939.1| hypothetical protein CARUB_v10027056mg [Capsella rubella] Length = 230 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 176 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 230 >gb|ABD65070.1| plastid ribosomal protein L19, putative [Brassica oleracea] Length = 224 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 170 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 224 >ref|XP_002870097.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] gi|297315933|gb|EFH46356.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] Length = 225 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 171 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 225 >ref|XP_002863352.1| hypothetical protein ARALYDRAFT_494259 [Arabidopsis lyrata subsp. lyrata] gi|297309187|gb|EFH39611.1| hypothetical protein ARALYDRAFT_494259 [Arabidopsis lyrata subsp. lyrata] Length = 222 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 168 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 222 >gb|ACF23041.1| ST10 [Eutrema halophilum] Length = 136 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 82 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 136 >gb|AAM64533.1| contains similarity to plastid ribosomal protein L19 [Arabidopsis thaliana] Length = 229 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 175 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|NP_568677.1| 50S ribosomal protein L19-2 [Arabidopsis thaliana] gi|75247671|sp|Q8RXX5.1|RK192_ARATH RecName: Full=50S ribosomal protein L19-2, chloroplastic; Flags: Precursor gi|19347900|gb|AAL85972.1| unknown protein [Arabidopsis thaliana] gi|21436235|gb|AAM51256.1| unknown protein [Arabidopsis thaliana] gi|332008099|gb|AED95482.1| 50S ribosomal protein L19-2 [Arabidopsis thaliana] Length = 229 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 175 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 229 >ref|NP_567531.1| 50S ribosomal protein L19-1 [Arabidopsis thaliana] gi|75248729|sp|Q8W463.1|RK191_ARATH RecName: Full=50S ribosomal protein L19-1, chloroplastic; Flags: Precursor gi|17065490|gb|AAL32899.1| Unknown protein [Arabidopsis thaliana] gi|20148593|gb|AAM10187.1| unknown protein [Arabidopsis thaliana] gi|21554252|gb|AAM63327.1| contains similarity to plastid ribosomal protein L19 [Arabidopsis thaliana] gi|332658510|gb|AEE83910.1| 50S ribosomal protein L19-1 [Arabidopsis thaliana] Length = 225 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 171 TTIRIRRIIAGIGVEIVFPIYSPNIKEIKVVSHRKVRRARLYYLRDKLPRLSTFK 225 >gb|EXC02074.1| 50S ribosomal protein L19-1 [Morus notabilis] Length = 265 Score = 105 bits (261), Expect = 8e-21 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 TTIRIRRVIAGVGVEIVFPVYSPNIKEIKVLKHRKVRRARLYYLRDKLPRLSTFK 167 TTIRIRR+IAG+GVEIVFP+YSPNIKEIKV+ HRKVRRARLYYLRDKLPRLSTFK Sbjct: 180 TTIRIRRIIAGIGVEIVFPLYSPNIKEIKVVNHRKVRRARLYYLRDKLPRLSTFK 234