BLASTX nr result
ID: Mentha25_contig00006357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006357 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018533.1| Uncharacterized protein TCM_034727 [Theobrom... 62 6e-08 ref|XP_006433620.1| hypothetical protein CICLE_v10002925mg [Citr... 61 2e-07 ref|XP_006433618.1| hypothetical protein CICLE_v10002925mg [Citr... 60 2e-07 gb|EYU36368.1| hypothetical protein MIMGU_mgv1a017259mg [Mimulus... 59 9e-07 gb|EYU21784.1| hypothetical protein MIMGU_mgv1a016995mg [Mimulus... 55 8e-06 >ref|XP_007018533.1| Uncharacterized protein TCM_034727 [Theobroma cacao] gi|508723861|gb|EOY15758.1| Uncharacterized protein TCM_034727 [Theobroma cacao] Length = 174 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 112 SGLIKLHKDVRTCEYEDVHILWELLKRNEAELARS 8 SGL+KL KDVR+CEYEDVH++WE+L+RNE E+ RS Sbjct: 114 SGLLKLRKDVRSCEYEDVHVMWEMLRRNETEVGRS 148 >ref|XP_006433620.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|557535742|gb|ESR46860.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] Length = 104 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 115 LSGLIKLHKDVRTCEYEDVHILWELLKRNEAELARS 8 L+GL++L +DVR+CEYEDV ++WE+LKRNE ELARS Sbjct: 36 LNGLLRLRRDVRSCEYEDVRVMWEMLKRNEPELARS 71 >ref|XP_006433618.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|567882121|ref|XP_006433619.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|557535740|gb|ESR46858.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] gi|557535741|gb|ESR46859.1| hypothetical protein CICLE_v10002925mg [Citrus clementina] Length = 94 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 112 SGLIKLHKDVRTCEYEDVHILWELLKRNEAELARS 8 SGL++L +DVR+CEYEDV ++WE+LKRNE ELARS Sbjct: 27 SGLLRLRRDVRSCEYEDVRVMWEMLKRNEPELARS 61 >gb|EYU36368.1| hypothetical protein MIMGU_mgv1a017259mg [Mimulus guttatus] Length = 86 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -2 Query: 112 SGLIKLHKDVRTCEYEDVHILWELLKRNEAELARSRK 2 +G++KL +DVRTCEYEDVHILW++LKR E +++ RK Sbjct: 29 TGIVKLQQDVRTCEYEDVHILWDMLKRKETDMSGRRK 65 >gb|EYU21784.1| hypothetical protein MIMGU_mgv1a016995mg [Mimulus guttatus] Length = 98 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -2 Query: 121 ENLSGLIKLHKDVRTCEYEDVHILWELLKRNEAEL 17 +N +GL+KLH DV+TCEYEDV I+WE+L+R E+E+ Sbjct: 26 KNGAGLLKLHDDVQTCEYEDVQIMWEMLRRTESEI 60