BLASTX nr result
ID: Mentha25_contig00006313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006313 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18110.1| hypothetical protein MIMGU_mgv1a000049mg [Mimulus... 60 3e-07 >gb|EYU18110.1| hypothetical protein MIMGU_mgv1a000049mg [Mimulus guttatus] Length = 2108 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -3 Query: 315 SHSMHTSYPPQS-MQPILFRPGSMPVNLYVNSLIPHHGEN 199 S SM SYPP M P+LFRP SMPVNLY N+L+PHHG+N Sbjct: 1908 SRSMQNSYPPTHLMPPLLFRPNSMPVNLYGNNLVPHHGDN 1947