BLASTX nr result
ID: Mentha25_contig00006274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006274 (477 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001591553.1| 60S ribosomal protein L29 [Sclerotinia scler... 102 7e-20 gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum g... 101 1e-19 ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubr... 101 1e-19 ref|XP_007590915.1| 60S ribosomal protein L29 [Colletotrichum fi... 101 1e-19 ref|XP_001550019.1| 60S ribosomal protein L29 [Botryotinia fucke... 101 1e-19 ref|XP_957786.1| 60S ribosomal protein L29 [Neurospora crassa OR... 101 1e-19 ref|XP_003171468.1| 60S ribosomal protein L29 [Arthroderma gypse... 101 1e-19 ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae ... 101 1e-19 gb|EHK48379.1| hypothetical protein TRIATDRAFT_297954 [Trichoder... 100 2e-19 ref|XP_003717249.1| 60S ribosomal protein L29 [Magnaporthe oryza... 100 2e-19 gb|EXJ88245.1| large subunit ribosomal protein L29e [Capronia co... 100 2e-19 ref|XP_001229506.1| 60S ribosomal protein L29 [Chaetomium globos... 100 3e-19 gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistrom... 100 3e-19 gb|EFX00346.1| peroxisomal carrier [Grosmannia clavigera kw1407] 100 3e-19 ref|XP_002624590.1| 60S ribosomal protein L29 [Ajellomyces derma... 100 3e-19 gb|ERT00720.1| 60S ribosomal protein L29 [Sporothrix schenckii A... 100 4e-19 gb|EJT72657.1| 60S ribosomal protein L29 [Gaeumannomyces gramini... 100 4e-19 ref|XP_003344300.1| 60S ribosomal protein L29 [Sordaria macrospo... 100 4e-19 ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides ... 100 4e-19 gb|EEH11222.1| conserved hypothetical protein [Ajellomyces capsu... 100 4e-19 >ref|XP_001591553.1| 60S ribosomal protein L29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154704777|gb|EDO04516.1| predicted protein [Sclerotinia sclerotiorum 1980 UF-70] Length = 65 Score = 102 bits (253), Expect = 7e-20 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKR++A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRESA 65 >gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum gloeosporioides Cg-14] Length = 393 Score = 101 bits (252), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKR+ A Sbjct: 344 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 393 >ref|XP_003233161.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|326464467|gb|EGD89920.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 118892] gi|607880408|gb|EZF25263.1| 60S ribosomal protein L29 [Trichophyton rubrum MR850] gi|607907085|gb|EZF44258.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 100081] gi|607919218|gb|EZF54948.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 288.86] gi|607931271|gb|EZF65566.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 289.86] gi|607955288|gb|EZF86859.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1448] gi|607967496|gb|EZF97649.1| 60S ribosomal protein L29 [Trichophyton rubrum MR1459] gi|607991495|gb|EZG19185.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 202.88] Length = 65 Score = 101 bits (252), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKRD+A Sbjct: 16 AHRNGIKKPKTDRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_007590915.1| 60S ribosomal protein L29 [Colletotrichum fioriniae PJ7] gi|310798355|gb|EFQ33248.1| ribosomal L29e family protein [Colletotrichum graminicola M1.001] gi|358380121|gb|EHK17800.1| hypothetical protein TRIVIDRAFT_88807 [Trichoderma virens Gv29-8] gi|380475206|emb|CCF45371.1| 60S ribosomal protein L29 [Colletotrichum higginsianum] gi|588905742|gb|EXF85442.1| 60S ribosomal protein L29 [Colletotrichum fioriniae PJ7] Length = 65 Score = 101 bits (252), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKR+ A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >ref|XP_001550019.1| 60S ribosomal protein L29 [Botryotinia fuckeliana B05.10] gi|347835053|emb|CCD49625.1| similar to 60S ribosomal protein L29 [Botryotinia fuckeliana T4] Length = 65 Score = 101 bits (252), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKR+ A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >ref|XP_957786.1| 60S ribosomal protein L29 [Neurospora crassa OR74A] gi|171685986|ref|XP_001907934.1| hypothetical protein [Podospora anserina S mat+] gi|28918881|gb|EAA28550.1| 60S ribosomal protein L29 [Neurospora crassa OR74A] gi|170942954|emb|CAP68607.1| unnamed protein product [Podospora anserina S mat+] gi|336469858|gb|EGO58020.1| hypothetical protein NEUTE1DRAFT_94929 [Neurospora tetrasperma FGSC 2508] gi|350290460|gb|EGZ71674.1| hypothetical protein NEUTE2DRAFT_121231 [Neurospora tetrasperma FGSC 2509] Length = 65 Score = 101 bits (252), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGT KALKEFKEGKR+ A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >ref|XP_003171468.1| 60S ribosomal protein L29 [Arthroderma gypseum CBS 118893] gi|311343811|gb|EFR03014.1| 60S ribosomal protein L29 [Arthroderma gypseum CBS 118893] Length = 65 Score = 101 bits (251), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKRD+A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >ref|XP_002846081.1| 60S ribosomal protein L29 [Arthroderma otae CBS 113480] gi|238843469|gb|EEQ33131.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|326476329|gb|EGE00339.1| 60S ribosomal protein L29 [Trichophyton tonsurans CBS 112818] gi|607892685|gb|EZF32010.1| 60S ribosomal protein L29 [Trichophyton interdigitale H6] gi|607943201|gb|EZF76196.1| 60S ribosomal protein L29 [Trichophyton soudanense CBS 452.61] gi|607979708|gb|EZG08705.1| 60S ribosomal protein L29 [Trichophyton rubrum CBS 735.88] Length = 65 Score = 101 bits (251), Expect = 1e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKRD+A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA 65 >gb|EHK48379.1| hypothetical protein TRIATDRAFT_297954 [Trichoderma atroviride IMI 206040] Length = 65 Score = 100 bits (250), Expect = 2e-19 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL GTDPKFRRNHRHALHGTMKALKE KEGKR+ A Sbjct: 16 AHRNGIKKPKTSRYPSLNGTDPKFRRNHRHALHGTMKALKELKEGKRETA 65 >ref|XP_003717249.1| 60S ribosomal protein L29 [Magnaporthe oryzae 70-15] gi|351643068|gb|EHA50930.1| 60S ribosomal protein L29 [Magnaporthe oryzae 70-15] gi|440475534|gb|ELQ44204.1| 60S ribosomal protein L29 [Magnaporthe oryzae Y34] gi|440478513|gb|ELQ59339.1| 60S ribosomal protein L29 [Magnaporthe oryzae P131] Length = 65 Score = 100 bits (250), Expect = 2e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGT KA+KEFKEGKR+ A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKAIKEFKEGKRETA 65 >gb|EXJ88245.1| large subunit ribosomal protein L29e [Capronia coronata CBS 617.96] Length = 121 Score = 100 bits (249), Expect = 2e-19 Identities = 52/81 (64%), Positives = 56/81 (69%) Frame = +1 Query: 7 TSFKVVYKYSTESKHKMAXXXXXXXXXXXXXAHRNGIKKPKTSRYPSLRGTDPKFRRNHR 186 T ++ S ES KMA AH+NGIKKPKT RYPSL+GTDPKFRRNHR Sbjct: 42 TLISCAFRRSPESV-KMAKSKNSSQHNQAKKAHKNGIKKPKTHRYPSLKGTDPKFRRNHR 100 Query: 187 HALHGTMKALKEFKEGKRDNA 249 HALHGTMKALKE KEGKRD A Sbjct: 101 HALHGTMKALKEVKEGKRDAA 121 >ref|XP_001229506.1| 60S ribosomal protein L29 [Chaetomium globosum CBS 148.51] gi|88183587|gb|EAQ91055.1| 60S ribosomal protein L29 [Chaetomium globosum CBS 148.51] Length = 65 Score = 100 bits (248), Expect = 3e-19 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGT KALKEFKEGKR+ A Sbjct: 16 AHRNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistroma septosporum NZE10] Length = 65 Score = 100 bits (248), Expect = 3e-19 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKRD A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDAA 65 >gb|EFX00346.1| peroxisomal carrier [Grosmannia clavigera kw1407] Length = 377 Score = 100 bits (248), Expect = 3e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL GTDPKFRRNHRHALHGT +ALKEFKEGKR++A Sbjct: 328 AHRNGIKKPKTSRYPSLNGTDPKFRRNHRHALHGTARALKEFKEGKRESA 377 >ref|XP_002624590.1| 60S ribosomal protein L29 [Ajellomyces dermatitidis SLH14081] gi|239595835|gb|EEQ78416.1| hypothetical protein BDBG_04454 [Ajellomyces dermatitidis SLH14081] gi|239609409|gb|EEQ86396.1| hypothetical protein BDCG_01516 [Ajellomyces dermatitidis ER-3] gi|327355856|gb|EGE84713.1| 60S ribosomal protein L29 [Ajellomyces dermatitidis ATCC 18188] gi|531980107|gb|EQL30694.1| large subunit ribosomal protein L29e [Ajellomyces dermatitidis ATCC 26199] Length = 65 Score = 100 bits (248), Expect = 3e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSLRGTDPKFRRNHRHALHGTMKALKE +EGKR++A Sbjct: 16 AHRNGIKKPKTHRYPSLRGTDPKFRRNHRHALHGTMKALKEMREGKRESA 65 >gb|ERT00720.1| 60S ribosomal protein L29 [Sporothrix schenckii ATCC 58251] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+GTDPKFRRNHRHALHGT +ALKEF+EGKR++A Sbjct: 16 AHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTARALKEFREGKRESA 65 >gb|EJT72657.1| 60S ribosomal protein L29 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKTSRYPSL+G DPKFRRNHRHALHGT KALKEFKEGKR+ A Sbjct: 16 AHRNGIKKPKTSRYPSLKGVDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >ref|XP_003344300.1| 60S ribosomal protein L29 [Sordaria macrospora k-hell] gi|380091828|emb|CCC10556.1| unnamed protein product [Sordaria macrospora k-hell] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGT KALKEFKEGKR+ A Sbjct: 16 AHRNGIKKPKTCRYPSLKGTDPKFRRNHRHALHGTAKALKEFKEGKRETA 65 >ref|XP_002792319.1| 60S ribosomal protein L29 [Paracoccidioides sp. 'lutzii' Pb01] gi|226278989|gb|EEH34555.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKR++A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65 >gb|EEH11222.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] gi|240279767|gb|EER43272.1| conserved hypothetical protein [Ajellomyces capsulatus H143] gi|325092897|gb|EGC46207.1| conserved hypothetical protein [Ajellomyces capsulatus H88] Length = 65 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +1 Query: 100 AHRNGIKKPKTSRYPSLRGTDPKFRRNHRHALHGTMKALKEFKEGKRDNA 249 AHRNGIKKPKT RYPSL+GTDPKFRRNHRHALHGTMKALKE KEGKR++A Sbjct: 16 AHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRESA 65