BLASTX nr result
ID: Mentha25_contig00006271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006271 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27399.1| hypothetical protein MIMGU_mgv1a001840mg [Mimulus... 55 8e-06 >gb|EYU27399.1| hypothetical protein MIMGU_mgv1a001840mg [Mimulus guttatus] Length = 751 Score = 55.5 bits (132), Expect = 8e-06 Identities = 41/96 (42%), Positives = 54/96 (56%), Gaps = 12/96 (12%) Frame = +1 Query: 7 SLDTVATPTNGCAS-PASATPPCISPVVVPTNG--ISYPDPITSREASPVPS-VCGDEDV 174 S+D +P +G A+ P+ +T SP VPT ++ SREASP PS ++D Sbjct: 644 SIDENPSPASGAAALPSPSTNGSASPSFVPTPDLLVAKDSSAYSREASPAPSGSVVEDDC 703 Query: 175 SITSEISQLAIDET--------ALAEDPVSDTATSA 258 SI SEIS LAID+T A ++P SDTATSA Sbjct: 704 SIVSEISSLAIDDTASDSVTSSAQVDEPPSDTATSA 739