BLASTX nr result
ID: Mentha25_contig00006270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006270 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27399.1| hypothetical protein MIMGU_mgv1a001840mg [Mimulus... 79 5e-13 >gb|EYU27399.1| hypothetical protein MIMGU_mgv1a001840mg [Mimulus guttatus] Length = 751 Score = 79.3 bits (194), Expect = 5e-13 Identities = 54/115 (46%), Positives = 68/115 (59%), Gaps = 9/115 (7%) Frame = +1 Query: 4 ASFSRGASPEPSVDEAPSPASVSLDTVTTPTNGCASPASATPPCISPVVVPMNGISYSDP 183 A+ SRG SPEPS+DE PSPAS + + TNG ASP+ P ++V + +Y Sbjct: 633 AASSRGGSPEPSIDENPSPASGAAALPSPSTNGSASPSFVPTP---DLLVAKDSSAY--- 686 Query: 184 ITSREASPVPS-VCGDEDISITSEISQLAIDET--------ALAEDPVSDTATSA 321 SREASP PS ++D SI SEIS LAID+T A ++P SDTATSA Sbjct: 687 --SREASPAPSGSVVEDDCSIVSEISSLAIDDTASDSVTSSAQVDEPPSDTATSA 739