BLASTX nr result
ID: Mentha25_contig00006246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006246 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270169.1| PREDICTED: polyribonucleotide nucleotidyltra... 64 3e-08 emb|CBI31225.3| unnamed protein product [Vitis vinifera] 57 4e-06 >ref|XP_002270169.1| PREDICTED: polyribonucleotide nucleotidyltransferase [Vitis vinifera] Length = 946 Score = 63.5 bits (153), Expect = 3e-08 Identities = 40/103 (38%), Positives = 54/103 (52%), Gaps = 7/103 (6%) Frame = -3 Query: 327 ALLPDPSPEKPSTKQRFVNPNKETTNTQKTEDKGKLKKTSSGAKNDDKVDNGELPQDNGI 148 ALLP+ +PEKPS KQR +KE +QK DKG KK + K+ N EL D Sbjct: 822 ALLPNANPEKPSLKQR--TSSKENAASQKAPDKGTTKKAVNMPKDGLGEVNVELSNDTSS 879 Query: 147 DVNTVEAETP-------MEYKFVKRFVSSEKDAAETNKSKPKR 40 + V + T + K +KR VSS +D +TNK +PK+ Sbjct: 880 NPKPVSSHTTNSAEGDALPQKIIKRLVSSGRDEPDTNKERPKK 922 >emb|CBI31225.3| unnamed protein product [Vitis vinifera] Length = 942 Score = 56.6 bits (135), Expect = 4e-06 Identities = 37/96 (38%), Positives = 50/96 (52%) Frame = -3 Query: 327 ALLPDPSPEKPSTKQRFVNPNKETTNTQKTEDKGKLKKTSSGAKNDDKVDNGELPQDNGI 148 ALLP+ +PEKPS KQR +KE +QK DKG KK + +P+D Sbjct: 822 ALLPNANPEKPSLKQR--TSSKENAASQKAPDKGTTKKAVN------------MPKDGLG 867 Query: 147 DVNTVEAETPMEYKFVKRFVSSEKDAAETNKSKPKR 40 +VN K +KR VSS +D +TNK +PK+ Sbjct: 868 EVN----------KIIKRLVSSGRDEPDTNKERPKK 893