BLASTX nr result
ID: Mentha25_contig00006233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006233 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660... 77 3e-12 ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660... 77 3e-12 ref|XP_006480841.1| PREDICTED: uncharacterized protein At2g37660... 76 6e-12 ref|XP_006429112.1| hypothetical protein CICLE_v10012166mg [Citr... 76 6e-12 ref|XP_006410956.1| hypothetical protein EUTSA_v10016917mg [Eutr... 76 6e-12 ref|XP_006294589.1| hypothetical protein CARUB_v10023624mg [Caps... 76 6e-12 ref|XP_007205763.1| hypothetical protein PRUPE_ppa010325mg [Prun... 76 6e-12 ref|NP_565868.1| NAD(P)-binding Rossmann-fold-containing protein... 76 6e-12 gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxy... 76 6e-12 dbj|BAH57079.1| AT2G37660 [Arabidopsis thaliana] 76 6e-12 gb|AFK40676.1| unknown [Lotus japonicus] 75 7e-12 gb|AFK33771.1| unknown [Lotus japonicus] 75 1e-11 ref|XP_002530987.1| conserved hypothetical protein [Ricinus comm... 75 1e-11 gb|AFK49538.1| unknown [Medicago truncatula] 74 2e-11 ref|XP_003563550.1| PREDICTED: uncharacterized protein At2g37660... 74 2e-11 gb|EXC30969.1| hypothetical protein L484_021269 [Morus notabilis] 74 2e-11 ref|XP_007140521.1| hypothetical protein PHAVU_008G1196000g, par... 74 3e-11 ref|NP_001241503.1| uncharacterized protein LOC100794855 [Glycin... 74 3e-11 gb|EPS62696.1| hypothetical protein M569_12093, partial [Genlise... 73 4e-11 ref|XP_004246424.1| PREDICTED: uncharacterized protein At2g37660... 73 4e-11 >ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like, partial [Cucumis sativus] Length = 236 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKALDLASKPEG GTPTKDFKALFSQ T+RF Sbjct: 195 CIQALQFEEAKFKALDLASKPEGVGTPTKDFKALFSQVTTRF 236 >ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like [Cucumis sativus] Length = 326 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKALDLASKPEG GTPTKDFKALFSQ T+RF Sbjct: 285 CIQALQFEEAKFKALDLASKPEGVGTPTKDFKALFSQVTTRF 326 >ref|XP_006480841.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like [Citrus sinensis] Length = 331 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+GTPTKDFKALFSQ T+RF Sbjct: 290 CIQALQFEEAKFKAFDLASKPEGTGTPTKDFKALFSQITTRF 331 >ref|XP_006429112.1| hypothetical protein CICLE_v10012166mg [Citrus clementina] gi|557531169|gb|ESR42352.1| hypothetical protein CICLE_v10012166mg [Citrus clementina] Length = 331 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+GTPTKDFKALFSQ T+RF Sbjct: 290 CIQALQFEEAKFKAFDLASKPEGTGTPTKDFKALFSQITTRF 331 >ref|XP_006410956.1| hypothetical protein EUTSA_v10016917mg [Eutrema salsugineum] gi|557112125|gb|ESQ52409.1| hypothetical protein EUTSA_v10016917mg [Eutrema salsugineum] Length = 330 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QAL +EEAKFKALDLASKPEG+GTPTKDFKALF+Q T++F Sbjct: 289 CVQALQLEEAKFKALDLASKPEGTGTPTKDFKALFAQVTTKF 330 >ref|XP_006294589.1| hypothetical protein CARUB_v10023624mg [Capsella rubella] gi|482563297|gb|EOA27487.1| hypothetical protein CARUB_v10023624mg [Capsella rubella] Length = 326 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QAL +EEAKFKALDLASKPEG+GTPTKDFKALF+Q T++F Sbjct: 285 CVQALQLEEAKFKALDLASKPEGTGTPTKDFKALFTQVTTKF 326 >ref|XP_007205763.1| hypothetical protein PRUPE_ppa010325mg [Prunus persica] gi|462401405|gb|EMJ06962.1| hypothetical protein PRUPE_ppa010325mg [Prunus persica] Length = 254 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+GTPTKDFKALFSQ T+RF Sbjct: 213 CIQALQFEEAKFKAFDLASKPEGTGTPTKDFKALFSQITTRF 254 >ref|NP_565868.1| NAD(P)-binding Rossmann-fold-containing protein [Arabidopsis thaliana] gi|22096383|sp|O80934.2|Y2766_ARATH RecName: Full=Uncharacterized protein At2g37660, chloroplastic; Flags: Precursor gi|14596079|gb|AAK68767.1| Unknown protein [Arabidopsis thaliana] gi|20148255|gb|AAM10018.1| unknown protein [Arabidopsis thaliana] gi|20197253|gb|AAC23636.2| expressed protein [Arabidopsis thaliana] gi|21537410|gb|AAM61751.1| putative 3-beta hydroxysteroid dehydrogenase/isomerase protein [Arabidopsis thaliana] gi|330254337|gb|AEC09431.1| NAD(P)-binding Rossmann-fold-containing protein [Arabidopsis thaliana] Length = 325 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QAL +EEAKFKALDLASKPEG+GTPTKDFKALF+Q T++F Sbjct: 284 CVQALQLEEAKFKALDLASKPEGTGTPTKDFKALFTQVTTKF 325 >gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxylum coca] Length = 253 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+GTPTKDFKALFSQ T+RF Sbjct: 212 CIQALQYEEAKFKAFDLASKPEGTGTPTKDFKALFSQITARF 253 >dbj|BAH57079.1| AT2G37660 [Arabidopsis thaliana] Length = 242 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QAL +EEAKFKALDLASKPEG+GTPTKDFKALF+Q T++F Sbjct: 201 CVQALQLEEAKFKALDLASKPEGTGTPTKDFKALFTQVTTKF 242 >gb|AFK40676.1| unknown [Lotus japonicus] Length = 313 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQALN EEA+FKA DLASKPEG+GTPT+DFKALFSQ T+RF Sbjct: 272 CIQALNFEEAQFKAFDLASKPEGAGTPTRDFKALFSQITTRF 313 >gb|AFK33771.1| unknown [Lotus japonicus] Length = 250 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QALN EE +FKA DLASKPEG GTPTKDFKALFSQ TSRF Sbjct: 209 CVQALNYEETQFKAFDLASKPEGVGTPTKDFKALFSQITSRF 250 >ref|XP_002530987.1| conserved hypothetical protein [Ricinus communis] gi|223529439|gb|EEF31399.1| conserved hypothetical protein [Ricinus communis] Length = 323 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+G+PTKDFKALFSQ T+RF Sbjct: 282 CIQALQFEEAKFKAFDLASKPEGTGSPTKDFKALFSQVTTRF 323 >gb|AFK49538.1| unknown [Medicago truncatula] Length = 329 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QALN EEA+FKA DLASKPEG+G+PTKDFKALFSQ T+RF Sbjct: 288 CLQALNFEEAQFKAFDLASKPEGTGSPTKDFKALFSQITTRF 329 >ref|XP_003563550.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like [Brachypodium distachyon] Length = 257 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 C+QAL EE KFKA DLASKPEG GTPTKDFKALFSQ TSRF Sbjct: 216 CVQALQYEETKFKAFDLASKPEGVGTPTKDFKALFSQVTSRF 257 >gb|EXC30969.1| hypothetical protein L484_021269 [Morus notabilis] Length = 323 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+GTPTKDFKALFSQ +RF Sbjct: 282 CIQALQFEEAKFKAFDLASKPEGAGTPTKDFKALFSQINTRF 323 >ref|XP_007140521.1| hypothetical protein PHAVU_008G1196000g, partial [Phaseolus vulgaris] gi|561013654|gb|ESW12515.1| hypothetical protein PHAVU_008G1196000g, partial [Phaseolus vulgaris] Length = 80 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQALN EEAKFKA DLASKPEG+G+ TKDFKALFSQ T+RF Sbjct: 39 CIQALNYEEAKFKAFDLASKPEGAGSATKDFKALFSQITTRF 80 >ref|NP_001241503.1| uncharacterized protein LOC100794855 [Glycine max] gi|255642211|gb|ACU21370.1| unknown [Glycine max] Length = 331 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQALN EEAKFKA DLASKPEG+G+ TKDFKALFSQ T+RF Sbjct: 290 CIQALNFEEAKFKAFDLASKPEGAGSATKDFKALFSQITTRF 331 >gb|EPS62696.1| hypothetical protein M569_12093, partial [Genlisea aurea] Length = 258 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQALN E+AKFKA DLASKPEGSGTPT+DF+ALFSQ T+ F Sbjct: 217 CIQALNYEDAKFKAFDLASKPEGSGTPTQDFRALFSQITTSF 258 >ref|XP_004246424.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like [Solanum lycopersicum] Length = 308 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 453 CIQALNVEEAKFKALDLASKPEGSGTPTKDFKALFSQATSRF 328 CIQAL EEAKFKA DLASKPEG+GTPTKDFKALF+Q ++RF Sbjct: 267 CIQALQYEEAKFKAFDLASKPEGTGTPTKDFKALFAQISTRF 308