BLASTX nr result
ID: Mentha25_contig00006223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006223 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC25826.1| hypothetical protein L484_019460 [Morus notabilis] 105 7e-21 ref|XP_006385487.1| hypothetical protein POPTR_0003s057201g, par... 104 1e-20 gb|EYU21570.1| hypothetical protein MIMGU_mgv1a006029mg [Mimulus... 102 4e-20 ref|XP_004302939.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 101 1e-19 ref|XP_007024030.1| P-loop containing nucleoside triphosphate hy... 100 2e-19 ref|XP_004235693.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 100 2e-19 ref|XP_002517532.1| D-glycerate 3-kinase, chloroplast precursor,... 100 2e-19 ref|XP_007150687.1| hypothetical protein PHAVU_005G173200g [Phas... 100 4e-19 ref|XP_002298133.2| hypothetical protein POPTR_0001s17750g [Popu... 100 4e-19 ref|XP_006343101.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 99 8e-19 ref|XP_003543660.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 99 8e-19 ref|NP_001242834.1| uncharacterized protein LOC100806896 [Glycin... 99 8e-19 ref|XP_007215355.1| hypothetical protein PRUPE_ppa005518mg [Prun... 98 1e-18 ref|XP_006465434.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 97 2e-18 ref|XP_006427107.1| hypothetical protein CICLE_v10025569mg [Citr... 97 2e-18 ref|XP_004966356.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 97 2e-18 ref|XP_004966355.1| PREDICTED: D-glycerate 3-kinase, chloroplast... 97 2e-18 ref|XP_006302248.1| hypothetical protein CARUB_v10020281mg [Caps... 97 3e-18 gb|AAL16169.1|AF428401_1 At1g80380/F5I6_13 [Arabidopsis thaliana] 97 3e-18 gb|AAG52441.1|AC018848_12 unknown protein; 45415-47304 [Arabidop... 97 3e-18 >gb|EXC25826.1| hypothetical protein L484_019460 [Morus notabilis] Length = 437 Score = 105 bits (262), Expect = 7e-21 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGMSDEEV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLLV+EIDEGRNPILAN Sbjct: 384 PGMSDEEVKDFVSRYLPAYNAYLPTLYSEGPNGSDPDHLLVIEIDEGRNPILAN 437 >ref|XP_006385487.1| hypothetical protein POPTR_0003s057201g, partial [Populus trichocarpa] gi|550342489|gb|ERP63284.1| hypothetical protein POPTR_0003s057201g, partial [Populus trichocarpa] Length = 103 Score = 104 bits (259), Expect = 1e-20 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGM+DEEV DFVSRYLPAYKAYLPTLYAEGP+GSDPE+LLV+EIDEGRNPIL N Sbjct: 50 PGMTDEEVKDFVSRYLPAYKAYLPTLYAEGPNGSDPENLLVIEIDEGRNPILGN 103 >gb|EYU21570.1| hypothetical protein MIMGU_mgv1a006029mg [Mimulus guttatus] Length = 460 Score = 102 bits (255), Expect = 4e-20 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +2 Query: 5 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 G+SDEEVLDFVSRYLPAYKAYLPTLYAEGP GSDP HLLVVEIDEGRNPIL + Sbjct: 408 GLSDEEVLDFVSRYLPAYKAYLPTLYAEGPKGSDPNHLLVVEIDEGRNPILGS 460 >ref|XP_004302939.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 452 Score = 101 bits (251), Expect = 1e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGMSD+EV DFVSRYLPAY AYLPTLY+EGP GSDP+HL+VVEIDEGRNPIL N Sbjct: 399 PGMSDDEVKDFVSRYLPAYNAYLPTLYSEGPRGSDPKHLIVVEIDEGRNPILGN 452 >ref|XP_007024030.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] gi|508779396|gb|EOY26652.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] Length = 448 Score = 100 bits (250), Expect = 2e-19 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGMSDEEV DFVSRYLPAYKAYLPTLY+EGP+GSDP+ LL++EIDEGRNPILA+ Sbjct: 395 PGMSDEEVKDFVSRYLPAYKAYLPTLYSEGPNGSDPKRLLLIEIDEGRNPILAD 448 >ref|XP_004235693.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Solanum lycopersicum] Length = 452 Score = 100 bits (250), Expect = 2e-19 Identities = 45/52 (86%), Positives = 51/52 (98%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPIL 157 PGMSDEEV DFVSRYLPAYKAYLPTLY+EGPSGSDP+H+L+++IDEGRNPIL Sbjct: 399 PGMSDEEVKDFVSRYLPAYKAYLPTLYSEGPSGSDPKHVLLIDIDEGRNPIL 450 >ref|XP_002517532.1| D-glycerate 3-kinase, chloroplast precursor, putative [Ricinus communis] gi|223543164|gb|EEF44696.1| D-glycerate 3-kinase, chloroplast precursor, putative [Ricinus communis] Length = 463 Score = 100 bits (249), Expect = 2e-19 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 160 PGM+DEEV DFVSRYLPAYKAYLPTLYAEGPSGSDPE++L+VEIDE RNPILA Sbjct: 410 PGMTDEEVKDFVSRYLPAYKAYLPTLYAEGPSGSDPENVLLVEIDEARNPILA 462 >ref|XP_007150687.1| hypothetical protein PHAVU_005G173200g [Phaseolus vulgaris] gi|561023951|gb|ESW22681.1| hypothetical protein PHAVU_005G173200g [Phaseolus vulgaris] Length = 437 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 160 PGM+DEEV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLL +EIDEGRNPILA Sbjct: 384 PGMTDEEVRDFVSRYLPAYYAYLPTLYSEGPNGSDPQHLLTIEIDEGRNPILA 436 >ref|XP_002298133.2| hypothetical protein POPTR_0001s17750g [Populus trichocarpa] gi|550347559|gb|EEE82938.2| hypothetical protein POPTR_0001s17750g [Populus trichocarpa] Length = 384 Score = 99.8 bits (247), Expect = 4e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGM+DEEV DFVSRYLPAYKAYLPTLYAEGP GS PE+LL++EIDEGRNPIL N Sbjct: 331 PGMTDEEVKDFVSRYLPAYKAYLPTLYAEGPRGSHPENLLLIEIDEGRNPILGN 384 >ref|XP_006343101.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Solanum tuberosum] Length = 382 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 5 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPIL 157 GM+DEEV DFVSRYLPAYKAYLPTLY+EGPSGSDPEH+L+++IDEGRNPIL Sbjct: 330 GMTDEEVKDFVSRYLPAYKAYLPTLYSEGPSGSDPEHVLLIDIDEGRNPIL 380 >ref|XP_003543660.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Glycine max] Length = 434 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 160 PGM+D+EV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLL +EIDEGRNPILA Sbjct: 381 PGMTDDEVRDFVSRYLPAYYAYLPTLYSEGPNGSDPQHLLTIEIDEGRNPILA 433 >ref|NP_001242834.1| uncharacterized protein LOC100806896 [Glycine max] gi|255639590|gb|ACU20089.1| unknown [Glycine max] Length = 438 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILA 160 PGM+D+EV DFVSRYLPAY AYLPTLY+EGP+GSDP+HLL +EIDEGRNPILA Sbjct: 385 PGMTDDEVRDFVSRYLPAYYAYLPTLYSEGPNGSDPQHLLTIEIDEGRNPILA 437 >ref|XP_007215355.1| hypothetical protein PRUPE_ppa005518mg [Prunus persica] gi|462411505|gb|EMJ16554.1| hypothetical protein PRUPE_ppa005518mg [Prunus persica] Length = 457 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGMSD+EV DFVSRYLPAY AYLPTLY+EGP GSDP+ L+V+EIDEGRNPIL N Sbjct: 404 PGMSDDEVKDFVSRYLPAYNAYLPTLYSEGPEGSDPKRLIVIEIDEGRNPILGN 457 >ref|XP_006465434.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like [Citrus sinensis] Length = 459 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPI 154 PGMSDEEV DFVSRYLPAY AYLPTLY+EGP+GSDPEH L++EID+GRNPI Sbjct: 409 PGMSDEEVKDFVSRYLPAYHAYLPTLYSEGPNGSDPEHTLIIEIDDGRNPI 459 >ref|XP_006427107.1| hypothetical protein CICLE_v10025569mg [Citrus clementina] gi|557529097|gb|ESR40347.1| hypothetical protein CICLE_v10025569mg [Citrus clementina] Length = 459 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPI 154 PGMSDEEV DFVSRYLPAY AYLPTLY+EGP+GSDPEH L++EID+GRNPI Sbjct: 409 PGMSDEEVKDFVSRYLPAYHAYLPTLYSEGPNGSDPEHTLIIEIDDGRNPI 459 >ref|XP_004966356.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like isoform X2 [Setaria italica] Length = 371 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGMSDEEV+DFVSRYLPAY AYLPTLY EGP+GS PEHLLV++IDE RNPI N Sbjct: 318 PGMSDEEVMDFVSRYLPAYHAYLPTLYKEGPNGSKPEHLLVIDIDEARNPIWGN 371 >ref|XP_004966355.1| PREDICTED: D-glycerate 3-kinase, chloroplastic-like isoform X1 [Setaria italica] Length = 420 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = +2 Query: 2 PGMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 PGMSDEEV+DFVSRYLPAY AYLPTLY EGP+GS PEHLLV++IDE RNPI N Sbjct: 367 PGMSDEEVMDFVSRYLPAYHAYLPTLYKEGPNGSKPEHLLVIDIDEARNPIWGN 420 >ref|XP_006302248.1| hypothetical protein CARUB_v10020281mg [Capsella rubella] gi|482570958|gb|EOA35146.1| hypothetical protein CARUB_v10020281mg [Capsella rubella] Length = 454 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +2 Query: 5 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 402 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 454 >gb|AAL16169.1|AF428401_1 At1g80380/F5I6_13 [Arabidopsis thaliana] Length = 456 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +2 Query: 5 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 404 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 456 >gb|AAG52441.1|AC018848_12 unknown protein; 45415-47304 [Arabidopsis thaliana] Length = 389 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +2 Query: 5 GMSDEEVLDFVSRYLPAYKAYLPTLYAEGPSGSDPEHLLVVEIDEGRNPILAN 163 GMSDEEV DFVSRYLPAYKAYLPTLYAEGPSGSDP+ +L ++IDE RNPILAN Sbjct: 337 GMSDEEVNDFVSRYLPAYKAYLPTLYAEGPSGSDPDRVLAIDIDEERNPILAN 389