BLASTX nr result
ID: Mentha25_contig00006103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006103 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40672.1| hypothetical protein MIMGU_mgv1a007852mg [Mimulus... 69 7e-10 >gb|EYU40672.1| hypothetical protein MIMGU_mgv1a007852mg [Mimulus guttatus] Length = 393 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/90 (40%), Positives = 46/90 (51%) Frame = -3 Query: 271 VGGENYAYYAEYSGASTDVSNVSTAGVDAGSYEGIDYSHAQGNHVGYPNYGSGYGDYANN 92 V N Y E + +++N AGS DYS+ G +V Y N G YG+Y ++ Sbjct: 215 VNNSNAKYLKEEEDPTNEITNGGAVDYTAGS--SYDYSYGDGQYVDYTNSGGSYGNYGDH 272 Query: 91 PQYENNWGNSAALPESSVSIENAMPVFKRR 2 QYENNW NS LPE S E A+ V RR Sbjct: 273 GQYENNWANSIPLPEVSAVAEEALRVPGRR 302