BLASTX nr result
ID: Mentha25_contig00006055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006055 (577 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366002.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 74 2e-11 gb|EYU35039.1| hypothetical protein MIMGU_mgv1a003370mg [Mimulus... 72 8e-11 ref|XP_004248148.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 72 8e-11 gb|EPS66086.1| hypothetical protein M569_08690, partial [Genlise... 67 4e-09 ref|XP_003564800.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 60 3e-07 ref|XP_006646545.1| PREDICTED: UPF0420 protein C16orf58 homolog,... 59 9e-07 ref|XP_004970837.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 59 9e-07 gb|EMT17447.1| hypothetical protein F775_27044 [Aegilops tauschii] 59 9e-07 tpg|DAA56462.1| TPA: hypothetical protein ZEAMMB73_966463 [Zea m... 59 9e-07 tpg|DAA56461.1| TPA: hypothetical protein ZEAMMB73_966463 [Zea m... 59 9e-07 dbj|BAJ91620.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 9e-07 gb|ACN31455.1| unknown [Zea mays] 59 9e-07 gb|EEE55775.1| hypothetical protein OsJ_04341 [Oryza sativa Japo... 59 9e-07 gb|ACL52948.1| unknown [Zea mays] 59 9e-07 ref|NP_001144348.1| uncharacterized protein LOC100277253 [Zea ma... 59 9e-07 ref|NP_001140509.1| uncharacterized protein LOC100272571 [Zea ma... 59 9e-07 dbj|BAD82242.1| unknown protein [Oryza sativa Japonica Group] gi... 59 9e-07 ref|XP_006654414.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 59 1e-06 dbj|BAJ94148.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 1e-06 gb|EEC79243.1| hypothetical protein OsI_19997 [Oryza sativa Indi... 59 1e-06 >ref|XP_006366002.1| PREDICTED: UPF0420 protein C16orf58 homolog [Solanum tuberosum] Length = 514 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 575 YKMVSALYGPFKTKVKEQGWVMSESLLNPGRARLCELAS 459 YKMVSALY PFK+K KEQGWVMSESLLNPGRARLCE+A+ Sbjct: 476 YKMVSALYMPFKSKAKEQGWVMSESLLNPGRARLCEMAT 514 >gb|EYU35039.1| hypothetical protein MIMGU_mgv1a003370mg [Mimulus guttatus] Length = 589 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 575 YKMVSALYGPFKTKVKEQGWVMSESLLNPGRARLCEL 465 YKMVSALYGPFK K KEQGWVMS+SLLNPGRARLC L Sbjct: 552 YKMVSALYGPFKNKAKEQGWVMSDSLLNPGRARLCGL 588 >ref|XP_004248148.1| PREDICTED: UPF0420 protein C16orf58 homolog [Solanum lycopersicum] Length = 514 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 575 YKMVSALYGPFKTKVKEQGWVMSESLLNPGRARLCELAS 459 YKMVSALY PFK+K KEQGWVMSESLLNPGRARLCE+ + Sbjct: 473 YKMVSALYIPFKSKAKEQGWVMSESLLNPGRARLCEMTT 511 >gb|EPS66086.1| hypothetical protein M569_08690, partial [Genlisea aurea] Length = 513 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 575 YKMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 YKMVSALYGPF K KEQGWVMSE+LLNPGR RLC Sbjct: 479 YKMVSALYGPFVDKAKEQGWVMSETLLNPGRPRLC 513 >ref|XP_003564800.1| PREDICTED: UPF0420 protein C16orf58 homolog [Brachypodium distachyon] Length = 506 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VSA YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 468 KLVSASYGTFKKKAREQGWIMSESLLNPGKARLC 501 >ref|XP_006646545.1| PREDICTED: UPF0420 protein C16orf58 homolog, partial [Oryza brachyantha] Length = 414 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 376 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 409 >ref|XP_004970837.1| PREDICTED: UPF0420 protein C16orf58 homolog [Setaria italica] Length = 509 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 471 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 504 >gb|EMT17447.1| hypothetical protein F775_27044 [Aegilops tauschii] Length = 377 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG F+ K KEQGW+MSESLLNPG+ARLC Sbjct: 339 KIVSSSYGTFRKKAKEQGWIMSESLLNPGKARLC 372 >tpg|DAA56462.1| TPA: hypothetical protein ZEAMMB73_966463 [Zea mays] gi|414879332|tpg|DAA56463.1| TPA: hypothetical protein ZEAMMB73_966463 [Zea mays] Length = 503 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 465 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 498 >tpg|DAA56461.1| TPA: hypothetical protein ZEAMMB73_966463 [Zea mays] Length = 115 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 77 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 110 >dbj|BAJ91620.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 80 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG F+ K KEQGW+MSESLLNPG+ARLC Sbjct: 42 KIVSSSYGTFRKKAKEQGWIMSESLLNPGKARLC 75 >gb|ACN31455.1| unknown [Zea mays] Length = 115 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 77 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 110 >gb|EEE55775.1| hypothetical protein OsJ_04341 [Oryza sativa Japonica Group] Length = 508 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 471 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 504 >gb|ACL52948.1| unknown [Zea mays] Length = 50 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 12 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 45 >ref|NP_001144348.1| uncharacterized protein LOC100277253 [Zea mays] gi|195640526|gb|ACG39731.1| hypothetical protein [Zea mays] Length = 503 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 465 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 498 >ref|NP_001140509.1| uncharacterized protein LOC100272571 [Zea mays] gi|194699768|gb|ACF83968.1| unknown [Zea mays] Length = 491 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 453 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 486 >dbj|BAD82242.1| unknown protein [Oryza sativa Japonica Group] gi|56785239|dbj|BAD82127.1| unknown protein [Oryza sativa Japonica Group] Length = 508 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+VS+ YG FK K +EQGW+MSESLLNPG+ARLC Sbjct: 471 KIVSSSYGTFKKKAREQGWIMSESLLNPGKARLC 504 >ref|XP_006654414.1| PREDICTED: UPF0420 protein C16orf58 homolog [Oryza brachyantha] Length = 415 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+V++ YG FK K +EQGW+MSESLLNPGRARLC Sbjct: 377 KIVTSSYGVFKKKAREQGWIMSESLLNPGRARLC 410 >dbj|BAJ94148.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 519 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLCELA 462 K+V++ YG FK K +EQGW+MS+SLLNPGRARLC +A Sbjct: 481 KIVTSSYGVFKRKAREQGWIMSDSLLNPGRARLCGVA 517 >gb|EEC79243.1| hypothetical protein OsI_19997 [Oryza sativa Indica Group] Length = 401 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 572 KMVSALYGPFKTKVKEQGWVMSESLLNPGRARLC 471 K+V++ YG FK K +EQGW+MSESLLNPGRARLC Sbjct: 363 KIVTSSYGVFKKKAREQGWIMSESLLNPGRARLC 396