BLASTX nr result
ID: Mentha25_contig00005184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00005184 (680 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrh... 66 9e-09 gb|ABS80935.1| putative NAC transcription factor [Avicennia marina] 63 1e-07 >gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrhiza] Length = 292 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 4/45 (8%) Frame = +1 Query: 1 YLDTQLNYMD--GFQDNLFNS--QMQLNDQFPLFPDMFAYMQKPF 123 YLDTQLN+MD GFQDN +N+ QMQ DQFPLF DM+A+MQKPF Sbjct: 248 YLDTQLNFMDAGGFQDNFYNAGAQMQYTDQFPLFSDMYAFMQKPF 292 >gb|ABS80935.1| putative NAC transcription factor [Avicennia marina] Length = 303 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +1 Query: 4 LDTQLNYMDGFQDNLFNSQMQLNDQFPLFPDMFAYMQKPF 123 LD L YMDGFQD+ F SQMQ DQ LFPDM+AYMQKPF Sbjct: 264 LDFPLIYMDGFQDDPFGSQMQYGDQLSLFPDMYAYMQKPF 303