BLASTX nr result
ID: Mentha25_contig00005009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00005009 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22905.1| hypothetical protein MIMGU_mgv1a003315mg [Mimulus... 58 1e-06 >gb|EYU22905.1| hypothetical protein MIMGU_mgv1a003315mg [Mimulus guttatus] Length = 593 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 198 TEPMSSISSNEIYGRVINDWQKGELLGRGTFGSVY 302 TEP+SS+S N + RVI DWQKGELLGRG+FGSVY Sbjct: 301 TEPLSSVSPNGRFRRVITDWQKGELLGRGSFGSVY 335