BLASTX nr result
ID: Mentha25_contig00004748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004748 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus... 62 6e-08 >gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus guttatus] Length = 769 Score = 62.4 bits (150), Expect = 6e-08 Identities = 37/76 (48%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = +2 Query: 95 QPVSSATGNFKCTSELNVADNSHNKNKKDHGTWIQRGSA-DSSQVK-VAHTGPSSTPEPT 268 QPV S + T E+N D SHNK+KK+ GTW QRGS+ DSS VK AH PS E T Sbjct: 379 QPVISMAAHVGSTVEINEGDVSHNKHKKELGTWKQRGSSTDSSHVKGGAHVEPSLKSELT 438 Query: 269 NEIQQSKELVQSERSE 316 +++QSK+ V + E Sbjct: 439 KDVKQSKDSVHLVKPE 454