BLASTX nr result
ID: Mentha25_contig00004668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004668 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22769.1| hypothetical protein MIMGU_mgv1a011590mg [Mimulus... 41 5e-06 ref|XP_007018157.1| Folic acid and derivative biosynthetic proce... 38 6e-06 ref|XP_007018147.1| Folic acid and derivative biosynthetic proce... 38 6e-06 >gb|EYU22769.1| hypothetical protein MIMGU_mgv1a011590mg [Mimulus guttatus] Length = 277 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 391 VDPLVIRHPKGHTIPRF 341 +DPLVIRHPKGHTIPRF Sbjct: 225 IDPLVIRHPKGHTIPRF 241 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -2 Query: 258 DEKGLESMLSFLERMQKDVEEEKKQQ 181 DEKGLE+MLSFL R+Q + E+E + + Sbjct: 242 DEKGLENMLSFLGRLQNEFEDEVEDE 267 >ref|XP_007018157.1| Folic acid and derivative biosynthetic process [Theobroma cacao] gi|508723485|gb|EOY15382.1| Folic acid and derivative biosynthetic process [Theobroma cacao] Length = 305 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 391 VDPLVIRHPKGHTIPRF 341 VDP+VI HPKGHTIPRF Sbjct: 251 VDPVVIHHPKGHTIPRF 267 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 16/33 (48%), Positives = 27/33 (81%) Frame = -2 Query: 258 DEKGLESMLSFLERMQKDVEEEKKQQDFSLENE 160 DEKGLES++SFLER+Q+ + E+++++ +S E Sbjct: 268 DEKGLESVMSFLERIQRMLPEKQEKEIYSTATE 300 >ref|XP_007018147.1| Folic acid and derivative biosynthetic process [Theobroma cacao] gi|508723475|gb|EOY15372.1| Folic acid and derivative biosynthetic process [Theobroma cacao] Length = 237 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 391 VDPLVIRHPKGHTIPRF 341 VDP+VI HPKGHTIPRF Sbjct: 183 VDPVVIHHPKGHTIPRF 199 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 16/33 (48%), Positives = 27/33 (81%) Frame = -2 Query: 258 DEKGLESMLSFLERMQKDVEEEKKQQDFSLENE 160 DEKGLES++SFLER+Q+ + E+++++ +S E Sbjct: 200 DEKGLESVMSFLERIQRMLPEKQEKEIYSTATE 232