BLASTX nr result
ID: Mentha25_contig00004574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004574 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006651743.1| PREDICTED: glutamine synthetase cytosolic is... 84 3e-14 ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozy... 84 3e-14 ref|XP_003570690.1| PREDICTED: glutamine synthetase cytosolic is... 82 8e-14 dbj|BAA04995.1| glutamine synthetase [Raphanus sativus] 82 1e-13 ref|NP_001051067.1| Os03g0712800 [Oryza sativa Japonica Group] g... 81 1e-13 gb|EEC76061.1| hypothetical protein OsI_13264 [Oryza sativa Indi... 81 1e-13 gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum] gi|1591... 81 1e-13 gb|ABW89463.1| glutamine synthetase [Gossypium raimondii] 81 1e-13 gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum] 81 1e-13 gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum] 81 1e-13 gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum] gi|159... 81 1e-13 ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutr... 81 2e-13 gb|AAK08103.1|AF338444_1 glutamine synthetase [Avicennia marina] 81 2e-13 gb|AFN42876.1| glutamine synthetase [Camellia sinensis] 81 2e-13 dbj|BAA04996.1| glutamine synthetase [Raphanus sativus] 80 2e-13 sp|P12424.1|GLNA_NICPL RecName: Full=Glutamine synthetase; AltNa... 80 2e-13 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo] 80 2e-13 ref|XP_006828438.1| hypothetical protein AMTR_s00060p00109730 [A... 80 3e-13 ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prun... 80 3e-13 gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] 80 3e-13 >ref|XP_006651743.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-3-like [Oryza brachyantha] Length = 364 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDL+N+DLSESTDKIIAEYVW+GG+GMD+RSKARTLSGP Sbjct: 1 MSLLTDLVNIDLSESTDKIIAEYVWVGGTGMDMRSKARTLSGP 43 >ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme-like [Fragaria vesca subsp. vesca] Length = 356 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDLINLDLS+STDKIIAEY+WIGGSGMDLRSKARTL GP Sbjct: 1 MSLLTDLINLDLSDSTDKIIAEYIWIGGSGMDLRSKARTLPGP 43 >ref|XP_003570690.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Brachypodium distachyon] Length = 356 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 M+LLTDL+NLDLS+ST+KIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MALLTDLLNLDLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGP 43 >dbj|BAA04995.1| glutamine synthetase [Raphanus sativus] Length = 356 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDLINLDLS++T+KIIAEY+W+GGSGMD+RSKARTLSGP Sbjct: 1 MSLLTDLINLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGP 43 >ref|NP_001051067.1| Os03g0712800 [Oryza sativa Japonica Group] gi|75317706|sp|Q4W8D0.1|GLN13_ORYSJ RecName: Full=Glutamine synthetase cytosolic isozyme 1-3; AltName: Full=Glutamate--ammonia ligase GLN1;3; Short=OsGLN1;3; AltName: Full=OsGS1;3 gi|13324800|gb|AAK18848.1|AC082645_18 putative glutamine synthetase [Oryza sativa Japonica Group] gi|66912123|dbj|BAD99301.1| cytosolic glutamine synthetase 1;3 [Oryza sativa Japonica Group] gi|108710733|gb|ABF98528.1| Glutamine synthetase root isozyme 2, putative, expressed [Oryza sativa Japonica Group] gi|113549538|dbj|BAF12981.1| Os03g0712800 [Oryza sativa Japonica Group] gi|215686655|dbj|BAG88908.1| unnamed protein product [Oryza sativa Japonica Group] gi|215708776|dbj|BAG94045.1| unnamed protein product [Oryza sativa Japonica Group] gi|222625674|gb|EEE59806.1| hypothetical protein OsJ_12330 [Oryza sativa Japonica Group] Length = 370 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/42 (85%), Positives = 42/42 (100%) Frame = -1 Query: 128 SLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 SLLTDL+NLDLSESTDK+IAEY+W+GG+GMD+RSKARTLSGP Sbjct: 4 SLLTDLVNLDLSESTDKVIAEYIWVGGTGMDVRSKARTLSGP 45 >gb|EEC76061.1| hypothetical protein OsI_13264 [Oryza sativa Indica Group] Length = 370 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/42 (85%), Positives = 42/42 (100%) Frame = -1 Query: 128 SLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 SLLTDL+NLDLSESTDK+IAEY+W+GG+GMD+RSKARTLSGP Sbjct: 4 SLLTDLVNLDLSESTDKVIAEYIWVGGTGMDVRSKARTLSGP 45 >gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum] gi|159138931|gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDL+NL+LS+ TDKIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGP 43 >gb|ABW89463.1| glutamine synthetase [Gossypium raimondii] Length = 356 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDL+NL+LS+ TDKIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGP 43 >gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDL+NL+LS+ TDKIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGP 43 >gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDL+NL+LS+ TDKIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGP 43 >gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum] gi|159138933|gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum] Length = 356 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDL+NL+LS+ TDKIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGP 43 >ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum] gi|557087798|gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum] Length = 356 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDLINLDLS+ST+KIIAEY+W+GGSGMD+RSKARTL GP Sbjct: 1 MSLLTDLINLDLSDSTEKIIAEYIWVGGSGMDMRSKARTLPGP 43 >gb|AAK08103.1|AF338444_1 glutamine synthetase [Avicennia marina] Length = 356 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLL+DL+NLDLSE+T+KIIAEYVW+GGSGMDLRSKART+SGP Sbjct: 1 MSLLSDLLNLDLSETTEKIIAEYVWVGGSGMDLRSKARTISGP 43 >gb|AFN42876.1| glutamine synthetase [Camellia sinensis] Length = 356 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLL+DLINLDLS++T+K+IAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLSDLINLDLSDTTEKVIAEYIWIGGSGMDLRSKARTLSGP 43 >dbj|BAA04996.1| glutamine synthetase [Raphanus sativus] Length = 356 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDLINL+LSE+TDKIIAEY+W+GGSGMD+RSKARTL GP Sbjct: 1 MSLLTDLINLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGP 43 >sp|P12424.1|GLNA_NICPL RecName: Full=Glutamine synthetase; AltName: Full=Glutamate--ammonia ligase gi|170221|gb|AAA34066.1| glutamine synthetase (EC 6.3.1.2) [Nicotiana plumbaginifolia] Length = 356 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLL+DLINL+LS+ST+KIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGP 43 >gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo] Length = 356 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/43 (88%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLL+DLINL+LS+ST+KIIAEY+WIGGSGMDLRSKARTLSGP Sbjct: 1 MSLLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGP 43 >ref|XP_006828438.1| hypothetical protein AMTR_s00060p00109730 [Amborella trichopoda] gi|548833186|gb|ERM95854.1| hypothetical protein AMTR_s00060p00109730 [Amborella trichopoda] Length = 356 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLLTDLINL+LS+ST+K+IAEY+WIGGSGMDLRSK RTLSGP Sbjct: 1 MSLLTDLINLNLSDSTEKVIAEYIWIGGSGMDLRSKGRTLSGP 43 >ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica] gi|462411755|gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica] Length = 356 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLL+DLINLDLS+ST+K+IAEY+WIGGSGMDLRSKARTL GP Sbjct: 1 MSLLSDLINLDLSDSTEKVIAEYIWIGGSGMDLRSKARTLPGP 43 >gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis] Length = 356 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 131 MSLLTDLINLDLSESTDKIIAEYVWIGGSGMDLRSKARTLSGP 3 MSLL+DLINL+LS++TDKIIAEY+WIGGSGMD+RSKARTLSGP Sbjct: 1 MSLLSDLINLNLSDTTDKIIAEYIWIGGSGMDMRSKARTLSGP 43