BLASTX nr result
ID: Mentha25_contig00003985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00003985 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213673.1| hypothetical protein PRUPE_ppa001058mg [Prun... 59 7e-07 >ref|XP_007213673.1| hypothetical protein PRUPE_ppa001058mg [Prunus persica] gi|462409538|gb|EMJ14872.1| hypothetical protein PRUPE_ppa001058mg [Prunus persica] Length = 921 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = +2 Query: 11 VEKNVNFSKSGSFKQHDQSNGVNFGGLPNGKVAGSKVDGNTV-PSPSPSADLTKPASCYP 187 V +N+N S+ FK D SNG+ GLPNGK A + +D + PS S + + ++ +P Sbjct: 653 VSRNMNLSQPVPFKMPD-SNGIVTRGLPNGKAASASLDNRMISPSDSAPSQSERTSAFFP 711 Query: 188 NERVQGLSNPVQMMRMMAD 244 + + QGLS+PVQ+M+ +A+ Sbjct: 712 HGQEQGLSDPVQLMKKLAE 730