BLASTX nr result
ID: Mentha25_contig00003903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00003903 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527855.1| ribosomal protein S9, putative [Ricinus comm... 55 8e-06 >ref|XP_002527855.1| ribosomal protein S9, putative [Ricinus communis] gi|223532779|gb|EEF34558.1| ribosomal protein S9, putative [Ricinus communis] Length = 152 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 311 ATAAMAAPTPKEAVQCFGRKKTAVAVTHCKRGR 409 A AA+AA E+VQCFGRKKTAVAVTHCKRGR Sbjct: 3 APAAVAAAATTESVQCFGRKKTAVAVTHCKRGR 35