BLASTX nr result
ID: Mentha25_contig00003818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00003818 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25057.1| hypothetical protein MIMGU_mgv1a009237mg [Mimulus... 73 5e-11 >gb|EYU25057.1| hypothetical protein MIMGU_mgv1a009237mg [Mimulus guttatus] Length = 348 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = +2 Query: 5 SPEYVGGPSPSPQREEGERAPNPDDYGRDRTPAYSDAESPPPDRF 139 SP+ V PSPS QRE GER P+PDDY RDR+P YSDAESPP DRF Sbjct: 291 SPDPVRDPSPSSQREPGERDPSPDDYARDRSPVYSDAESPPRDRF 335