BLASTX nr result
ID: Mentha25_contig00003592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00003592 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21510.1| hypothetical protein MIMGU_mgv1a012762mg [Mimulus... 62 8e-08 >gb|EYU21510.1| hypothetical protein MIMGU_mgv1a012762mg [Mimulus guttatus] Length = 241 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 463 HDSSRCTCIFAVCWDHDNLEGKVTAEKLCYRPNKSAPKESE 341 HDSSRCTC+F V +DHDN+EGKV KLC RP KS K +E Sbjct: 184 HDSSRCTCLFVVRYDHDNVEGKVPLHKLCCRPAKSVSKGNE 224