BLASTX nr result
ID: Mentha25_contig00002406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002406 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC73569.1| hypothetical protein OsI_08011 [Oryza sativa Indi... 75 7e-12 ref|XP_007033634.1| ACT domain-containing small subunit of aceto... 75 1e-11 ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|50... 75 1e-11 ref|XP_002529819.1| acetolactate synthase, putative [Ricinus com... 74 2e-11 ref|XP_006470698.1| PREDICTED: acetolactate synthase small subun... 74 3e-11 ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citr... 74 3e-11 ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citr... 74 3e-11 ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cuc... 74 3e-11 ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212... 74 3e-11 dbj|BAD19594.1| putative acetolactate synthase small subunit [Or... 74 3e-11 ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group] g... 74 3e-11 gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japo... 74 3e-11 gb|AFK41430.1| unknown [Lotus japonicus] 73 4e-11 ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Popu... 73 5e-11 ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutr... 72 8e-11 ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Caps... 72 8e-11 ref|XP_003532793.1| PREDICTED: acetolactate synthase small subun... 72 8e-11 ref|XP_003524233.1| PREDICTED: acetolactate synthase small subun... 72 8e-11 ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arab... 72 8e-11 ref|NP_850173.2| ACT domain-containing small subunit of acetolac... 72 8e-11 >gb|EEC73569.1| hypothetical protein OsI_08011 [Oryza sativa Indica Group] Length = 554 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFSV 304 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFS+ Sbjct: 518 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFSL 554 >ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] gi|508712663|gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] Length = 478 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFSV 304 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF V Sbjct: 442 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 478 >ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|508712662|gb|EOY04559.1| Poly(A) polymerase 1 [Theobroma cacao] Length = 788 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFSV 304 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF V Sbjct: 752 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 788 >ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis] gi|223530696|gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis] Length = 493 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFSV 304 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYSF + Sbjct: 457 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSFPI 493 >ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Citrus sinensis] Length = 488 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 452 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 486 >ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548810|gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 488 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 452 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 486 >ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548809|gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 471 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 435 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 469 >ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus] Length = 412 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 376 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 410 >ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus] Length = 489 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 453 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 487 >dbj|BAD19594.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] gi|47497949|dbj|BAD20154.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] Length = 323 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 287 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 321 >ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group] gi|255671076|dbj|BAF09303.2| Os02g0608600, partial [Oryza sativa Japonica Group] Length = 340 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 304 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 338 >gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group] Length = 422 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF Sbjct: 386 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 420 >gb|AFK41430.1| unknown [Lotus japonicus] Length = 478 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYSF Sbjct: 442 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSF 476 >ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] gi|550333837|gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] Length = 490 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFSV 304 RLLEPYGICEVARTGR+AL RESGVDSKYLRGYSF V Sbjct: 454 RLLEPYGICEVARTGRIALTRESGVDSKYLRGYSFPV 490 >ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum] gi|557111478|gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum] Length = 491 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSF Sbjct: 453 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSF 487 >ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] gi|482562801|gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] Length = 492 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSF Sbjct: 454 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSF 488 >ref|XP_003532793.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Glycine max] Length = 474 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYS+ Sbjct: 438 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSY 472 >ref|XP_003524233.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Glycine max] Length = 476 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYS+ Sbjct: 440 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSY 474 >ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] gi|297325183|gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] Length = 492 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSF Sbjct: 454 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSF 488 >ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|330253493|gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] Length = 421 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 414 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSF 310 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSF Sbjct: 383 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSF 417