BLASTX nr result
ID: Mentha25_contig00002325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002325 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32333.1| hypothetical protein MIMGU_mgv1a016128mg [Mimulus... 64 2e-08 >gb|EYU32333.1| hypothetical protein MIMGU_mgv1a016128mg [Mimulus guttatus] Length = 133 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 309 LISAVKQLLLKSLDSPRSSPVKKRCLLRSHSCYSALD 199 LISAVKQLLL+SLDSPRSSPV+KRC++RS SC+SAL+ Sbjct: 96 LISAVKQLLLRSLDSPRSSPVRKRCMVRSESCFSALN 132