BLASTX nr result
ID: Mentha25_contig00002000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002000 (618 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250604.1| PREDICTED: uncharacterized protein LOC101246... 65 2e-08 ref|XP_006361373.1| PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE... 64 5e-08 gb|EYU37473.1| hypothetical protein MIMGU_mgv1a025085mg, partial... 62 1e-07 ref|XP_007034024.1| Ubiquitin carboxyl-terminal hydrolase family... 61 2e-07 ref|XP_006844748.1| hypothetical protein AMTR_s00016p00255910 [A... 58 2e-06 gb|ABK96426.1| unknown [Populus trichocarpa x Populus deltoides] 58 2e-06 ref|XP_002302883.1| hypothetical protein POPTR_0002s23160g [Popu... 58 3e-06 ref|XP_002532674.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_004250604.1| PREDICTED: uncharacterized protein LOC101246785 [Solanum lycopersicum] Length = 764 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERNGSEDE-VLRVPFSGRRSPCKMLTE 437 QL+EKHPL +IREK+A+MMK GFL+RSRG+YK G E+E L F G + ++ Sbjct: 523 QLIEKHPLVQIREKFANMMKQGFLNRSRGLYKDTNQGPEEEKSLTSSFVGETCGTRYYSD 582 Query: 436 IGRRLIIMINHE 401 IG + + HE Sbjct: 583 IGSDSGMCLEHE 594 >ref|XP_006361373.1| PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1-like isoform X1 [Solanum tuberosum] gi|565391327|ref|XP_006361374.1| PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1-like isoform X2 [Solanum tuberosum] Length = 414 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERNGSEDE 491 QL+EKHPL +IREK+A+MMK GFLDRSRG+YK G E+E Sbjct: 333 QLIEKHPLVQIREKFANMMKQGFLDRSRGLYKDNNQGPEEE 373 >gb|EYU37473.1| hypothetical protein MIMGU_mgv1a025085mg, partial [Mimulus guttatus] Length = 407 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 616 GQLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERNGSED 494 G L EKHPLA+IR KY MMK G LDRSRG+YK+E GSE+ Sbjct: 343 GNLNEKHPLADIRGKYVGMMKKGLLDRSRGLYKKESKGSEE 383 >ref|XP_007034024.1| Ubiquitin carboxyl-terminal hydrolase family protein [Theobroma cacao] gi|508713053|gb|EOY04950.1| Ubiquitin carboxyl-terminal hydrolase family protein [Theobroma cacao] Length = 657 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERN-GSEDEVLRVPFSGRRSPCKMLTE 437 +L+++HPL +IR+++ASMM+ GFLDRSRG+YK+ N G ED VP S S C + +E Sbjct: 587 RLIQRHPLVDIRKRFASMMRKGFLDRSRGLYKKTVNVGHEDPSKIVPGSEVESDCDLFSE 646 >ref|XP_006844748.1| hypothetical protein AMTR_s00016p00255910 [Amborella trichopoda] gi|548847219|gb|ERN06423.1| hypothetical protein AMTR_s00016p00255910 [Amborella trichopoda] Length = 396 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRE 512 QL+EKHPL +IREKY MMK+GFL+RSRG+YK+E Sbjct: 336 QLVEKHPLVDIREKYIEMMKTGFLNRSRGLYKKE 369 >gb|ABK96426.1| unknown [Populus trichocarpa x Populus deltoides] Length = 413 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERNGSEDEVLRV 479 QL+ KHPL +IR KYASMM+ GFLDRSRG+YK+ + +E + V Sbjct: 349 QLLHKHPLVDIRGKYASMMRKGFLDRSRGLYKKTASSGPEESMIV 393 >ref|XP_002302883.1| hypothetical protein POPTR_0002s23160g [Populus trichocarpa] gi|222844609|gb|EEE82156.1| hypothetical protein POPTR_0002s23160g [Populus trichocarpa] Length = 413 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERNGSEDEVLRV 479 QL+ KHPL +IR KYASMM+ GFLDRSRG+YK+ + +E + V Sbjct: 349 QLIHKHPLVDIRGKYASMMRKGFLDRSRGLYKKTASSGPEESMIV 393 >ref|XP_002532674.1| conserved hypothetical protein [Ricinus communis] gi|223527587|gb|EEF29702.1| conserved hypothetical protein [Ricinus communis] Length = 404 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -3 Query: 613 QLMEKHPLAEIREKYASMMKSGFLDRSRGVYKRERNGSEDEVLRV 479 QL++KHPL +IRE+YAS+M G LDRSRG+YK+ S ++ L V Sbjct: 348 QLLQKHPLVDIRERYASLMSRGLLDRSRGLYKKNTTASLEDSLEV 392