BLASTX nr result
ID: Mentha25_contig00001980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00001980 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006377344.1| hypothetical protein POPTR_0011s05100g [Popu... 56 4e-06 >ref|XP_006377344.1| hypothetical protein POPTR_0011s05100g [Populus trichocarpa] gi|550327632|gb|ERP55141.1| hypothetical protein POPTR_0011s05100g [Populus trichocarpa] Length = 504 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +3 Query: 111 EKNLQILLEAFGSAVSLDAIASSYCETGRNLESTAEMLRNMQGSISAT 254 EK L++LLEAFGS SL+ IAS+YC+ GRN + T ++L++M+G S + Sbjct: 15 EKALEVLLEAFGSKFSLEQIASAYCKAGRNADLTVQILQDMEGGASTS 62