BLASTX nr result
ID: Mentha25_contig00001141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00001141 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28019.1| Cell division protein FtsY-like protein [Morus no... 115 8e-24 ref|XP_002511808.1| cell division protein ftsy, putative [Ricinu... 115 8e-24 ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citr... 112 5e-23 ref|XP_007051904.1| Signal recognition particle receptor protein... 112 7e-23 ref|XP_007051903.1| Signal recognition particle receptor protein... 112 7e-23 ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolo... 112 7e-23 ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago ... 112 7e-23 gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlise... 111 9e-23 ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolo... 111 9e-23 ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phas... 110 2e-22 ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [A... 110 2e-22 ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolo... 110 2e-22 ref|XP_002320775.1| signal recognition particle receptor family ... 110 2e-22 ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prun... 110 2e-22 ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prun... 110 2e-22 ref|XP_006339450.1| PREDICTED: cell division protein FtsY homolo... 110 3e-22 gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] 110 3e-22 gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum... 110 3e-22 dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgar... 110 3e-22 ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolo... 109 3e-22 >gb|EXC28019.1| Cell division protein FtsY-like protein [Morus notabilis] Length = 371 Score = 115 bits (287), Expect = 8e-24 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIFP Sbjct: 315 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 371 >ref|XP_002511808.1| cell division protein ftsy, putative [Ricinus communis] gi|223548988|gb|EEF50477.1| cell division protein ftsy, putative [Ricinus communis] Length = 362 Score = 115 bits (287), Expect = 8e-24 Identities = 56/57 (98%), Positives = 57/57 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIFP Sbjct: 306 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 362 >ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|567905284|ref|XP_006445130.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|568875898|ref|XP_006491027.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Citrus sinensis] gi|557547391|gb|ESR58369.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|557547392|gb|ESR58370.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] Length = 372 Score = 112 bits (280), Expect = 5e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 316 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_007051904.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] gi|508704165|gb|EOX96061.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] Length = 365 Score = 112 bits (279), Expect = 7e-23 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITG ILTKLDGSARGGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 309 VGITGFILTKLDGSARGGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 365 >ref|XP_007051903.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] gi|508704164|gb|EOX96060.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] Length = 445 Score = 112 bits (279), Expect = 7e-23 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITG ILTKLDGSARGGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 389 VGITGFILTKLDGSARGGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 445 >ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cicer arietinum] Length = 365 Score = 112 bits (279), Expect = 7e-23 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 309 VGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago truncatula] gi|355521650|gb|AET02104.1| Signal recognition 54 kDa protein [Medicago truncatula] Length = 402 Score = 112 bits (279), Expect = 7e-23 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 346 VGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlisea aurea] Length = 330 Score = 111 bits (278), Expect = 9e-23 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFD +AFVNAIFP Sbjct: 274 VGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDPQAFVNAIFP 330 >ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Glycine max] gi|571443916|ref|XP_006576355.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Glycine max] Length = 372 Score = 111 bits (278), Expect = 9e-23 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VG+TGL+LTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 316 VGVTGLVLTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] gi|561008046|gb|ESW06995.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] Length = 371 Score = 110 bits (276), Expect = 2e-22 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDA+AFVNAIF Sbjct: 315 VGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDADAFVNAIF 370 >ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] gi|548861955|gb|ERN19320.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] Length = 402 Score = 110 bits (276), Expect = 2e-22 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VGITGLILTKLDGSARGGCV SVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 346 VGITGLILTKLDGSARGGCVASVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Glycine max] Length = 372 Score = 110 bits (276), Expect = 2e-22 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAE+FVNAIF Sbjct: 316 VGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371 >ref|XP_002320775.1| signal recognition particle receptor family protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| signal recognition particle receptor family protein [Populus trichocarpa] Length = 365 Score = 110 bits (276), Expect = 2e-22 Identities = 54/56 (96%), Positives = 55/56 (98%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VGITG ILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 309 VGITGFILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] gi|462416829|gb|EMJ21566.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] Length = 333 Score = 110 bits (275), Expect = 2e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VGITGLILTKLDGSARGGCVVSVV+ELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 277 VGITGLILTKLDGSARGGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 332 >ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] gi|462414630|gb|EMJ19367.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] Length = 365 Score = 110 bits (275), Expect = 2e-22 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIF 204 VGITGLILTKLDGSARGGCVVSVV+ELGIPVKFVGVGEG+EDLQPFDAEAFVNAIF Sbjct: 309 VGITGLILTKLDGSARGGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_006339450.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Solanum tuberosum] Length = 368 Score = 110 bits (274), Expect = 3e-22 Identities = 53/57 (92%), Positives = 56/57 (98%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEG++DLQPF+AE FVNAIFP Sbjct: 312 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVDDLQPFNAEEFVNAIFP 368 >gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] Length = 370 Score = 110 bits (274), Expect = 3e-22 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFV AIFP Sbjct: 314 VGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 370 >gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum urartu] Length = 336 Score = 110 bits (274), Expect = 3e-22 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFV AIFP Sbjct: 280 VGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 336 >dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532852|dbj|BAJ89271.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 110 bits (274), Expect = 3e-22 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVGVGEG+EDLQPFDAEAFV AIFP Sbjct: 299 VGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 355 >ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolog [Brachypodium distachyon] Length = 360 Score = 109 bits (273), Expect = 3e-22 Identities = 52/57 (91%), Positives = 55/57 (96%) Frame = -2 Query: 371 VGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGIEDLQPFDAEAFVNAIFP 201 VGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVG+GEG+EDLQPFDAEAFV AIFP Sbjct: 304 VGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGIGEGVEDLQPFDAEAFVEAIFP 360