BLASTX nr result
ID: Mentha24_contig00041416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041416 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21692.1| hypothetical protein MIMGU_mgv1a019845mg [Mimulus... 40 3e-06 >gb|EYU21692.1| hypothetical protein MIMGU_mgv1a019845mg [Mimulus guttatus] Length = 454 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +3 Query: 96 PSEFGCEALAWMMAVNVCFLFK 161 P FGCEALAWMMAV+V FLF+ Sbjct: 119 PLGFGCEALAWMMAVDVSFLFE 140 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 22/43 (51%), Positives = 25/43 (58%), Gaps = 9/43 (20%) Frame = +1 Query: 1 MERYKVAVAKRL*RELNKVKLQ---------TLRIRACYHLPV 102 MERYKVA AKR R+L K + Q LRIRA YH P+ Sbjct: 78 MERYKVAAAKRNQRDLQKSRFQDFIDHLMKFELRIRASYHRPL 120