BLASTX nr result
ID: Mentha24_contig00041302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00041302 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32773.1| hypothetical protein MIMGU_mgv1a001943mg [Mimulus... 55 8e-06 gb|EYU45185.1| hypothetical protein MIMGU_mgv1a0003261mg, partia... 55 1e-05 >gb|EYU32773.1| hypothetical protein MIMGU_mgv1a001943mg [Mimulus guttatus] Length = 735 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/57 (52%), Positives = 42/57 (73%), Gaps = 3/57 (5%) Frame = +1 Query: 19 DTDANVEKDEENI-VGTPSLEERDAKEGIQNFESND--QQQRIEAIKKGREREKDKI 180 +T N+EK++EN+ T + ++D+K Q E+ND QQQRIEAIK+GREREKD+I Sbjct: 435 ETGQNMEKNKENLGETTTTTAQKDSKSNEQTSETNDDDQQQRIEAIKRGREREKDRI 491 >gb|EYU45185.1| hypothetical protein MIMGU_mgv1a0003261mg, partial [Mimulus guttatus] Length = 1159 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = +1 Query: 31 NVEKDEENIVGTPSLEERDAKEGIQNFESNDQQQRIEAIKKGREREKDKI 180 N++K++EN+ AKE +QN E N+ QQRIEAIKKGREREKD+I Sbjct: 858 NMDKNKENLA---------AKESLQNDEKNEHQQRIEAIKKGREREKDRI 898