BLASTX nr result
ID: Mentha24_contig00031831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031831 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68491.1| hypothetical protein M569_06280 [Genlisea aurea] 58 2e-06 ref|XP_006366088.1| PREDICTED: uncharacterized protein LOC102596... 56 6e-06 >gb|EPS68491.1| hypothetical protein M569_06280 [Genlisea aurea] Length = 71 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 1 RKANARKRLRRV*QNEAVLRACSETPPQEVSQAEGSRN 114 RKANA+KRLRRV QNEAVL+ACSE PPQE+SQ N Sbjct: 34 RKANAKKRLRRVWQNEAVLKACSEPPPQEMSQVATKEN 71 >ref|XP_006366088.1| PREDICTED: uncharacterized protein LOC102596532 [Solanum tuberosum] Length = 82 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 1 RKANARKRLRRV*QNEAVLRACSETPPQEVSQAEGSR 111 RKANA+KRLRRV QNEAVLRACSE PP E S+ + + Sbjct: 35 RKANAKKRLRRVWQNEAVLRACSEAPPSETSEVDAGQ 71