BLASTX nr result
ID: Mentha24_contig00031822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031822 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39557.1| hypothetical protein MIMGU_mgv1a014203mg [Mimulus... 114 1e-23 gb|EYU39556.1| hypothetical protein MIMGU_mgv1a014203mg [Mimulus... 114 1e-23 ref|XP_007009712.1| Nuclear transcription factor Y subunit B-10 ... 114 2e-23 ref|XP_007009711.1| Nuclear transcription factor Y subunit B-10 ... 114 2e-23 ref|XP_007009710.1| Nuclear transcription factor Y subunit B-10 ... 114 2e-23 ref|XP_004237523.1| PREDICTED: nuclear transcription factor Y su... 114 2e-23 ref|NP_001274952.1| transcription factor NF-Y CCAAT-binding-like... 114 2e-23 ref|XP_002278716.1| PREDICTED: nuclear transcription factor Y su... 114 2e-23 ref|XP_002278772.1| PREDICTED: nuclear transcription factor Y su... 114 2e-23 emb|CBI31520.3| unnamed protein product [Vitis vinifera] 114 2e-23 ref|XP_006361771.1| PREDICTED: nuclear transcription factor Y su... 112 5e-23 ref|XP_006361770.1| PREDICTED: nuclear transcription factor Y su... 112 5e-23 ref|XP_006361769.1| PREDICTED: nuclear transcription factor Y su... 112 5e-23 ref|XP_006373864.1| hypothetical protein POPTR_0016s08600g [Popu... 112 5e-23 emb|CDF47513.1| nuclear transcription factor Y subunit B-8-like ... 112 5e-23 ref|XP_007027240.1| Nuclear transcription factor Y subunit B-10 ... 112 5e-23 ref|XP_007027239.1| Nuclear transcription factor Y subunit B-10 ... 112 5e-23 ref|XP_007027238.1| Nuclear transcription factor Y subunit B-10 ... 112 5e-23 ref|XP_007027237.1| Nuclear transcription factor Y subunit B-10 ... 112 5e-23 ref|XP_007027236.1| Nuclear transcription factor Y subunit B-10 ... 112 5e-23 >gb|EYU39557.1| hypothetical protein MIMGU_mgv1a014203mg [Mimulus guttatus] Length = 175 Score = 114 bits (286), Expect = 1e-23 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +3 Query: 129 VREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 VRE DRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISF+TSEASDKCQKEK Sbjct: 34 VREQDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEK 91 >gb|EYU39556.1| hypothetical protein MIMGU_mgv1a014203mg [Mimulus guttatus] Length = 197 Score = 114 bits (286), Expect = 1e-23 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +3 Query: 129 VREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 VRE DRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISF+TSEASDKCQKEK Sbjct: 34 VREQDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEK 91 >ref|XP_007009712.1| Nuclear transcription factor Y subunit B-10 isoform 3 [Theobroma cacao] gi|508726625|gb|EOY18522.1| Nuclear transcription factor Y subunit B-10 isoform 3 [Theobroma cacao] Length = 177 Score = 114 bits (284), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK Sbjct: 29 NVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 87 >ref|XP_007009711.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] gi|590564617|ref|XP_007009713.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] gi|508726624|gb|EOY18521.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] gi|508726626|gb|EOY18523.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] Length = 178 Score = 114 bits (284), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK Sbjct: 29 NVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 87 >ref|XP_007009710.1| Nuclear transcription factor Y subunit B-10 isoform 1 [Theobroma cacao] gi|508726623|gb|EOY18520.1| Nuclear transcription factor Y subunit B-10 isoform 1 [Theobroma cacao] Length = 179 Score = 114 bits (284), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK Sbjct: 29 NVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 87 >ref|XP_004237523.1| PREDICTED: nuclear transcription factor Y subunit B-8-like isoform 1 [Solanum lycopersicum] gi|460383634|ref|XP_004237524.1| PREDICTED: nuclear transcription factor Y subunit B-8-like isoform 2 [Solanum lycopersicum] Length = 165 Score = 114 bits (284), Expect = 2e-23 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 N+RE DR+LPIANIGRIMKKALPANGKIAKD+KDTVQECVSEFISFITSEASDKCQKEK Sbjct: 25 NLREQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEK 83 >ref|NP_001274952.1| transcription factor NF-Y CCAAT-binding-like protein-like [Solanum tuberosum] gi|565346835|ref|XP_006340452.1| PREDICTED: nuclear transcription factor Y subunit B-10 isoform X2 [Solanum tuberosum] gi|565346837|ref|XP_006340453.1| PREDICTED: nuclear transcription factor Y subunit B-10 isoform X3 [Solanum tuberosum] gi|81074849|gb|ABB55377.1| transcription factor NF-Y CCAAT-binding-like protein-like [Solanum tuberosum] gi|81076282|gb|ABB55391.1| transcription factor NF-Y CCAAT-binding-like protein-like [Solanum tuberosum] gi|82400142|gb|ABB72810.1| transcription factor NF-Y, CCAAT-binding-like protein [Solanum tuberosum] Length = 165 Score = 114 bits (284), Expect = 2e-23 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 N+RE DR+LPIANIGRIMKKALPANGKIAKD+KDTVQECVSEFISFITSEASDKCQKEK Sbjct: 25 NLREQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEK 83 >ref|XP_002278716.1| PREDICTED: nuclear transcription factor Y subunit B-8-like isoform 1 [Vitis vinifera] gi|359486707|ref|XP_003633465.1| PREDICTED: nuclear transcription factor Y subunit B-8-like [Vitis vinifera] Length = 178 Score = 114 bits (284), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK Sbjct: 24 NVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 82 >ref|XP_002278772.1| PREDICTED: nuclear transcription factor Y subunit B-8-like isoform 2 [Vitis vinifera] Length = 161 Score = 114 bits (284), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK Sbjct: 24 NVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 82 >emb|CBI31520.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 114 bits (284), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK Sbjct: 24 NVREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 82 >ref|XP_006361771.1| PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X3 [Solanum tuberosum] Length = 163 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DRFLPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQ+EK Sbjct: 31 NVREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREK 89 >ref|XP_006361770.1| PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 [Solanum tuberosum] Length = 176 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DRFLPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQ+EK Sbjct: 31 NVREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREK 89 >ref|XP_006361769.1| PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 [Solanum tuberosum] Length = 180 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DRFLPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQ+EK Sbjct: 31 NVREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREK 89 >ref|XP_006373864.1| hypothetical protein POPTR_0016s08600g [Populus trichocarpa] gi|550321127|gb|ERP51661.1| hypothetical protein POPTR_0016s08600g [Populus trichocarpa] Length = 181 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DRFLPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQ+EK Sbjct: 26 NVREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREK 84 >emb|CDF47513.1| nuclear transcription factor Y subunit B-8-like [Cucumis sativus] Length = 171 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DRFLPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQ+EK Sbjct: 23 NVREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREK 81 >ref|XP_007027240.1| Nuclear transcription factor Y subunit B-10 isoform 5 [Theobroma cacao] gi|508715845|gb|EOY07742.1| Nuclear transcription factor Y subunit B-10 isoform 5 [Theobroma cacao] Length = 180 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQKEK Sbjct: 86 NVREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEK 144 >ref|XP_007027239.1| Nuclear transcription factor Y subunit B-10 isoform 4 [Theobroma cacao] gi|508715844|gb|EOY07741.1| Nuclear transcription factor Y subunit B-10 isoform 4 [Theobroma cacao] Length = 234 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQKEK Sbjct: 86 NVREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEK 144 >ref|XP_007027238.1| Nuclear transcription factor Y subunit B-10 isoform 3 [Theobroma cacao] gi|508715843|gb|EOY07740.1| Nuclear transcription factor Y subunit B-10 isoform 3 [Theobroma cacao] Length = 233 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQKEK Sbjct: 86 NVREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEK 144 >ref|XP_007027237.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] gi|508715842|gb|EOY07739.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] Length = 233 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQKEK Sbjct: 86 NVREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEK 144 >ref|XP_007027236.1| Nuclear transcription factor Y subunit B-10 isoform 1 [Theobroma cacao] gi|508715841|gb|EOY07738.1| Nuclear transcription factor Y subunit B-10 isoform 1 [Theobroma cacao] Length = 235 Score = 112 bits (280), Expect = 5e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 126 NVREHDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEK 302 NVRE DR+LPIANI RIMKKALPANGKIAKDAK+TVQECVSEFISFITSEASDKCQKEK Sbjct: 86 NVREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEK 144