BLASTX nr result
ID: Mentha24_contig00031614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031614 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62657.1| hypothetical protein M569_12133, partial [Genlise... 72 8e-11 >gb|EPS62657.1| hypothetical protein M569_12133, partial [Genlisea aurea] Length = 289 Score = 72.0 bits (175), Expect = 8e-11 Identities = 39/80 (48%), Positives = 48/80 (60%) Frame = -1 Query: 242 SRFLSPVGGPLFLFNPPWKXXXXXXXXXXXSDIVLNFLKLRAINLLHQPAFRYKLEHSAP 63 SR SP+ GPLFL NPPWK SD VLNFL+LRA+NLL +P F Y L + P Sbjct: 1 SRIFSPIVGPLFLSNPPWKLLQSSTPLLLQSDAVLNFLRLRALNLLRRPNFEYGLSPN-P 59 Query: 62 RLLNESVREEFRNGAEIEAS 3 RLLN+ +F+ I+ S Sbjct: 60 RLLNKDRASQFQKPTVIDGS 79