BLASTX nr result
ID: Mentha24_contig00031603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031603 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45165.1| hypothetical protein MIMGU_mgv1a001015mg [Mimulus... 56 6e-06 >gb|EYU45165.1| hypothetical protein MIMGU_mgv1a001015mg [Mimulus guttatus] Length = 912 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +3 Query: 354 SVATTQLAPRLSYPTEWPALLDLRSSLGISARNWHKKAN 470 + A Q PRLS TEW AL DLRSSLGI A++WHKKAN Sbjct: 23 AAAAAQPVPRLSSQTEWRALFDLRSSLGIRAKDWHKKAN 61