BLASTX nr result
ID: Mentha24_contig00029930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029930 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35528.1| hypothetical protein MIMGU_mgv1a016093mg [Mimulus... 55 8e-06 >gb|EYU35528.1| hypothetical protein MIMGU_mgv1a016093mg [Mimulus guttatus] Length = 134 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 330 KELNGRVVFVDYAKPRSGSSRDTMPIARGPPGPIAES 220 K LNGR VFVDYAKPRSGSS ++MPIARGPP P ++ Sbjct: 99 KPLNGRTVFVDYAKPRSGSS-NSMPIARGPPEPAPQN 134