BLASTX nr result
ID: Mentha24_contig00028151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00028151 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 84 2e-14 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 83 5e-14 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 79 5e-13 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 77 3e-12 ref|NP_001117603.1| conserved peptide upstream open reading fram... 77 3e-12 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 75 1e-11 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 74 3e-11 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 73 5e-11 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 71 1e-10 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 69 5e-10 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 68 1e-09 ref|XP_006581196.1| PREDICTED: uncharacterized protein LOC100809... 66 6e-09 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 65 1e-08 ref|NP_001119115.1| conserved peptide upstream open reading fram... 65 1e-08 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 63 5e-08 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 63 5e-08 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 61 1e-07 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 61 1e-07 ref|XP_007131799.1| hypothetical protein PHAVU_011G042700g [Phas... 59 7e-07 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 57 2e-06 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|593795374|ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSPVLSE+LRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|590593628|ref|XP_007017623.1| Peptide upstream open reading frame 5 [Theobroma cacao] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSPV+SE+LRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSPVLSE+LRSGF+I+SSL+RRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSPV+SE+LRSG I+SSLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 13 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSPV+SE+LRSG I+SSLRRRTHLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|593792796|ref|XP_007159437.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 362 LMSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 + SPV+SE+L SGF INSSLRRRTHLVQSFSVVFL+WFYVFS Sbjct: 1 MSSPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 M+PV+SEVL SGF INS+LRR THLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS*INT 499 MS +LSE L SGF+INSS RRRTHLVQSFS+VFLYWFYVFS I T Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWFYVFSIIFT 45 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSPV+ E+ SGFMINS+LRRRTHLVQSFSVVFLYWFY+FS Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MS +LSE + SGFMINS+LRR THLV SFSVVFLYWFYVFS Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWFYVFS 41 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MS +LSE+ SGFMINS+ RRRTHLVQSFSVVFLYWFY S Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_006581196.1| PREDICTED: uncharacterized protein LOC100809564 [Glycine max] Length = 52 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 377 LSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS*INT 499 LSE +R FMINSS RRRTHLVQSFSVVFLYWFYVFS I+T Sbjct: 6 LSEFIR--FMINSSFRRRTHLVQSFSVVFLYWFYVFSLIST 44 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MS +L+E+ GFMINS+ RRRTHLVQSFSVVFLYWFY S Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/42 (73%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +2 Query: 365 MSPV-LSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSP+ LSE+ SGFM+NS++RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|593267553|ref|XP_007135954.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 M P+LSE+ SG MINS++RRRTHLVQSFSV FLYW Y S Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 MSP LSE+L S MINS+ RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 M +LSE+ SG MINS++RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFY 478 M+PVL E+L SG + S+L RRTHLVQSFSVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >ref|XP_007131799.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] gi|561004799|gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 487 M +LSE+ SG MINS++RRRTHLVQSFSV FLYW Y S Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +2 Query: 365 MSPVLSEVLRSGFMINSSLRRRTHLVQSFSVVFLYWFYV 481 M +LSE+ SG MINS++RRRTHLVQSFSVVFLY F+V Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYCFWV 39