BLASTX nr result
ID: Mentha24_contig00028031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00028031 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC30920.1| hypothetical protein L484_028102 [Morus notabilis] 61 1e-07 >gb|EXC30920.1| hypothetical protein L484_028102 [Morus notabilis] Length = 804 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = +2 Query: 200 MKETDRRKGPSNKERNRPARPETRDRKLPGKNVSKNLKGKEIDAKPSSDK-NSNSLGSDM 376 MKE D+RK P+N R +PE RD+K N K L K+ K S K +S +L SD+ Sbjct: 1 MKEVDKRKTPNNNRTKRAGKPEKRDQKPNQGNTGKTLNVKDTQTKASHAKPDSRTLVSDL 60 Query: 377 KNGAEPSEVFE 409 GAEPSEV+E Sbjct: 61 NTGAEPSEVYE 71