BLASTX nr result
ID: Mentha24_contig00027970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00027970 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007162466.1| hypothetical protein PHAVU_001G154700g [Phas... 57 2e-06 >ref|XP_007162466.1| hypothetical protein PHAVU_001G154700g [Phaseolus vulgaris] gi|561035930|gb|ESW34460.1| hypothetical protein PHAVU_001G154700g [Phaseolus vulgaris] Length = 366 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 9/80 (11%) Frame = -1 Query: 423 EALAMEMQGSRKGKXXXXXXXXA---------GLDEGFWQELLNEGFDFDEERGAGEDCE 271 E LA+EMQG +GK A LDEGFW+EL +EGF+ + D + Sbjct: 287 EVLALEMQGYGRGKREQEEEPEALESQERLEKELDEGFWEELFSEGFEGELHIPTSPDQD 346 Query: 270 EGEDVNALARRLGFLASSSK 211 E EDVN LA R G+L SS + Sbjct: 347 EEEDVNVLANRFGYLGSSPR 366