BLASTX nr result
ID: Mentha24_contig00017644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00017644 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46280.1| hypothetical protein MIMGU_mgv1a000094mg [Mimulus... 65 8e-09 >gb|EYU46280.1| hypothetical protein MIMGU_mgv1a000094mg [Mimulus guttatus] Length = 1828 Score = 65.5 bits (158), Expect = 8e-09 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 1 RGRGRKFQTGGEAPAPRRRGKRQTAALQTVQITSSAPVIDSPAVEVQAE 147 RGRGRK +T GEAP PRRRGKRQ A QT+QIT+S PV D P E+Q E Sbjct: 1568 RGRGRKPRTAGEAPVPRRRGKRQNAVEQTIQITASPPVTDQPP-EIQRE 1615