BLASTX nr result
ID: Mentha24_contig00016079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00016079 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007033634.1| ACT domain-containing small subunit of aceto... 78 1e-12 ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|50... 78 1e-12 ref|XP_002529819.1| acetolactate synthase, putative [Ricinus com... 77 2e-12 ref|XP_006470698.1| PREDICTED: acetolactate synthase small subun... 77 3e-12 ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citr... 77 3e-12 ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citr... 77 3e-12 ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cuc... 77 3e-12 ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212... 77 3e-12 dbj|BAD19594.1| putative acetolactate synthase small subunit [Or... 77 3e-12 ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group] g... 77 3e-12 gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japo... 77 3e-12 gb|AFK41430.1| unknown [Lotus japonicus] 76 4e-12 ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Popu... 76 5e-12 ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutr... 75 9e-12 ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Caps... 75 9e-12 ref|XP_003532793.1| PREDICTED: acetolactate synthase small subun... 75 9e-12 ref|XP_003524233.1| PREDICTED: acetolactate synthase small subun... 75 9e-12 ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arab... 75 9e-12 ref|NP_850173.2| ACT domain-containing small subunit of acetolac... 75 9e-12 ref|NP_850172.1| ACT domain-containing small subunit of acetolac... 75 9e-12 >ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] gi|508712663|gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] Length = 478 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV Sbjct: 442 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 478 >ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|508712662|gb|EOY04559.1| Poly(A) polymerase 1 [Theobroma cacao] Length = 788 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV Sbjct: 752 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 788 >ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis] gi|223530696|gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis] Length = 493 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYSFP+ Sbjct: 457 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSFPI 493 >ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Citrus sinensis] Length = 488 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 452 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 488 >ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548810|gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 488 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 452 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 488 >ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548809|gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 471 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 435 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 471 >ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus] Length = 412 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 376 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 412 >ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus] Length = 489 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 453 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 489 >dbj|BAD19594.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] gi|47497949|dbj|BAD20154.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] Length = 323 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 287 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 323 >ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group] gi|255671076|dbj|BAF09303.2| Os02g0608600, partial [Oryza sativa Japonica Group] Length = 340 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 304 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 340 >gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group] Length = 422 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFP+ Sbjct: 386 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 422 >gb|AFK41430.1| unknown [Lotus japonicus] Length = 478 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYSFP+ Sbjct: 442 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSFPL 478 >ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] gi|550333837|gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] Length = 490 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGR+AL RESGVDSKYLRGYSFPV Sbjct: 454 RLLEPYGICEVARTGRIALTRESGVDSKYLRGYSFPV 490 >ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum] gi|557111478|gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum] Length = 491 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSFP+ Sbjct: 453 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSFPL 489 >ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] gi|482562801|gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] Length = 492 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSFP+ Sbjct: 454 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSFPL 490 >ref|XP_003532793.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Glycine max] Length = 474 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYS+P+ Sbjct: 438 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSYPL 474 >ref|XP_003524233.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Glycine max] Length = 476 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGR+ALVRESGVDSKYLRGYS+P+ Sbjct: 440 RLLEPYGICEVARTGRIALVRESGVDSKYLRGYSYPL 476 >ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] gi|297325183|gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] Length = 492 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSFP+ Sbjct: 454 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSFPL 490 >ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|330253493|gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] Length = 421 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSFP+ Sbjct: 383 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSFPL 419 >ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|75249445|sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; AltName: Full=Acetohydroxy-acid synthase small subunit; Short=AHAS; Short=ALS; Flags: Precursor gi|16604523|gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|21655295|gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|330253492|gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] Length = 491 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 RLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPV 113 RLLEPYGICEVARTGRVAL RESGVDSKYLRGYSFP+ Sbjct: 453 RLLEPYGICEVARTGRVALARESGVDSKYLRGYSFPL 489