BLASTX nr result
ID: Mentha24_contig00015490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00015490 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35940.1| hypothetical protein MIMGU_mgv1a003184mg [Mimulus... 77 2e-12 >gb|EYU35940.1| hypothetical protein MIMGU_mgv1a003184mg [Mimulus guttatus] Length = 602 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/59 (57%), Positives = 46/59 (77%) Frame = -1 Query: 372 YNDRRMINEHQLNIPLKNDTVSKKRFREEFPHQQPPRATLLVDSTPQNYQVIRSATEMP 196 Y+DRRM+NE+++NIP KND + +KR REEFP QQ + + +VD+ P YQV+RSA EMP Sbjct: 527 YHDRRMVNENRVNIPSKNDFIGQKRMREEFPQQQYLKRSPIVDNLPPTYQVVRSAAEMP 585