BLASTX nr result
ID: Mentha24_contig00015165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00015165 (1021 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992313.1| ribosomal protein S4 (mitochondrion) [Salvia... 69 2e-09 ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclep... 69 4e-09 ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica ... 68 5e-09 ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|375911... 68 7e-09 sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitoc... 68 7e-09 gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] 68 7e-09 dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [N... 67 1e-08 ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 67 2e-08 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 67 2e-08 ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. m... 65 4e-08 ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgari... 65 4e-08 ref|YP_006460178.1| ribosomal protein subunit S4 (mitochondrion)... 65 6e-08 gb|EPS74675.1| hypothetical protein M569_00050 [Genlisea aurea] 64 1e-07 ref|YP_005090421.1| rps4 gene product (mitochondrion) [Boea hygr... 62 5e-07 gb|AGL75402.1| ribosomal protein S4 (mitochondrion) [Utricularia... 61 8e-07 gb|AHA47128.1| ribosomal protein S4 (mitochondrion) [Amborella t... 60 2e-06 gb|EXB57808.1| hypothetical protein L484_002790 [Morus notabilis] 59 2e-06 ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|... 59 3e-06 gb|EXB66620.1| Ribosomal protein S4 [Morus notabilis] 59 4e-06 ref|YP_006280945.1| ribosomal protein S4 (mitochondrion) [Spirod... 58 5e-06 >ref|YP_008992313.1| ribosomal protein S4 (mitochondrion) [Salvia miltiorrhiza] gi|534292286|gb|AGU16578.1| ribosomal protein S4 (mitochondrion) [Salvia miltiorrhiza] Length = 351 Score = 69.3 bits (168), Expect = 2e-09 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -2 Query: 561 SPQQLGTNRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCW 382 SP Q NR R+N I+LPTHY EVNH+ KA++ YGP+I HIP + +KD NLL Sbjct: 283 SPHQFTMNRKRKNRKIKRIELPTHYSEVNHRTPKAVVSYGPNIGHIPHDIRLKDPNLLLR 342 Query: 381 SEHER 367 S +ER Sbjct: 343 SGNER 347 >ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] gi|556562347|gb|AGZ63043.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] Length = 274 Score = 68.6 bits (166), Expect = 4e-09 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = -2 Query: 561 SPQQLGTNRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCW 382 SP Q R R+ +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL W Sbjct: 211 SPHQFTMKRKRKRI-----ELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLW 265 Query: 381 SEHER 367 S + R Sbjct: 266 SGNGR 270 >ref|YP_002000578.1| ribosomal protein S4 [Oryza sativa Japonica Group] gi|92700092|dbj|BAC19883.2| Ribosomal protein S4 [Oryza sativa Japonica Group] Length = 352 Score = 68.2 bits (165), Expect = 5e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -2 Query: 534 FRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 F R I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS + R Sbjct: 293 FTRKIRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGR 348 >ref|YP_717175.1| ribosomal protein S4 [Brassica napus] gi|37591124|dbj|BAC98926.1| ribosomal protein S4 [Brassica napus] Length = 362 Score = 67.8 bits (164), Expect = 7e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS + R Sbjct: 313 ELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 67.8 bits (164), Expect = 7e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS + R Sbjct: 313 ELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >gb|ACH78250.1| ribosomal protein S4 [Arabidopsis thaliana] Length = 362 Score = 67.8 bits (164), Expect = 7e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS + R Sbjct: 313 ELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDLNLLLWSRNGR 358 >dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 67.0 bits (162), Expect = 1e-08 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -2 Query: 540 NRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 379 ++F + I+LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 288 HQFTKKIKIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWS 341 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 66.6 bits (161), Expect = 2e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS + R Sbjct: 309 ELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGR 354 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 66.6 bits (161), Expect = 2e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNLL WS + R Sbjct: 309 ELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGR 354 >ref|YP_004222288.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|317905723|emb|CBJ14108.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|319439803|emb|CBJ17515.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] Length = 315 Score = 65.1 bits (157), Expect = 4e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 379 +LPTHY EVNH+ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 266 ELPTHYSEVNHRTLKAVVFYGPNIDHIPHDIRLKDLNLLLWS 307 >ref|NP_064046.2| rps4 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|346683270|ref|YP_004842202.1| ribosomal protein S4 [Beta macrocarpa] gi|87248052|gb|ABD36080.1| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|148491424|dbj|BAA99356.2| ribosomal protein S4 [Beta vulgaris subsp. vulgaris] gi|320148708|emb|CBJ23346.1| ribosomal protein S4 [Beta vulgaris subsp. maritima] gi|345500188|emb|CBX25007.1| ribosomal protein S4 [Beta macrocarpa] gi|384939188|emb|CBL52035.1| ribosoma lprotein S4 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 315 Score = 65.1 bits (157), Expect = 4e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWS 379 +LPTHY EVNH+ KA++FYGP+I HIP + +KDLNLL WS Sbjct: 266 ELPTHYSEVNHRTLKAVVFYGPNIDHIPHDIRLKDLNLLLWS 307 >ref|YP_006460178.1| ribosomal protein subunit S4 (mitochondrion) [Mimulus guttatus] gi|340007672|gb|AEK26536.1| ribosomal protein subunit S4 (mitochondrion) [Mimulus guttatus] Length = 353 Score = 64.7 bits (156), Expect = 6e-08 Identities = 32/65 (49%), Positives = 41/65 (63%) Frame = -2 Query: 561 SPQQLGTNRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCW 382 SP Q R R+ I+LPTHY EVNH+ KA++ YGP+I HIP + +KD NLL Sbjct: 285 SPHQFTMKRKRKKRKIKRIELPTHYSEVNHRTPKAVVSYGPNIGHIPHDIRLKDPNLLLR 344 Query: 381 SEHER 367 S +ER Sbjct: 345 SGNER 349 >gb|EPS74675.1| hypothetical protein M569_00050 [Genlisea aurea] Length = 354 Score = 63.9 bits (154), Expect = 1e-07 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = -2 Query: 561 SPQQLGTNRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCW 382 SP Q R R+ I+LPTHYLEVNH+ +KA++ YGP+I HIP + +KD NLL Sbjct: 289 SPHQFTMKRKRK---IKRIELPTHYLEVNHRTQKAVVSYGPNIGHIPHDIRLKDPNLLLR 345 Query: 381 SEHER 367 S +ER Sbjct: 346 SRNER 350 >ref|YP_005090421.1| rps4 gene product (mitochondrion) [Boea hygrometrica] gi|340549497|gb|AEK53318.1| ribosomal protein S4 (mitochondrion) [Boea hygrometrica] Length = 329 Score = 61.6 bits (148), Expect = 5e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHY EVNH+ KA++FYGP+I HIP + +KD NLL S +ER Sbjct: 280 ELPTHYSEVNHRTPKAVVFYGPNIGHIPHDIRLKDPNLLLRSGNER 325 >gb|AGL75402.1| ribosomal protein S4 (mitochondrion) [Utricularia gibba] Length = 370 Score = 60.8 bits (146), Expect = 8e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHYLEVNH+ KA++ YGP+I HIP + +KD NLL S +ER Sbjct: 317 ELPTHYLEVNHRTPKAVISYGPNIGHIPHDIRLKDPNLLLRSGNER 362 >gb|AHA47128.1| ribosomal protein S4 (mitochondrion) [Amborella trichopoda] Length = 354 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -2 Query: 540 NRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +RF R I+LPTHYLEVN++ KA++FYGP I HIP + +KD NL S + R Sbjct: 284 HRFTRKRRIKRIELPTHYLEVNYRTLKAVVFYGPDIGHIPHDIRLKDPNLPLRSRNGR 341 >gb|EXB57808.1| hypothetical protein L484_002790 [Morus notabilis] Length = 263 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLL 388 +LPTHYLEVNH+ KA++ YGP+I HIP + +KDLNLL Sbjct: 214 ELPTHYLEVNHRTPKAMVSYGPNIGHIPHDIRLKDLNLL 252 >ref|YP_003587235.1| ribosomal protein S4 [Citrullus lanatus] gi|259156791|gb|ACV96653.1| ribosomal protein S4 [Citrullus lanatus] Length = 355 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNL 391 +LPTHYLEVN++ KA++FYGP+I HIP + +KDLNL Sbjct: 306 ELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNL 343 >gb|EXB66620.1| Ribosomal protein S4 [Morus notabilis] Length = 307 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 504 DLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNLLCWSEHER 367 +LPTHY EVNH+ KA++ YGP+I HIP + +KDLNLL S + R Sbjct: 258 ELPTHYSEVNHRTPKAVVSYGPNIGHIPHDIRLKDLNLLLRSGNGR 303 >ref|YP_006280945.1| ribosomal protein S4 (mitochondrion) [Spirodela polyrhiza] gi|385252646|gb|AFI54954.1| ribosomal protein S4 (mitochondrion) [Spirodela polyrhiza] Length = 349 Score = 58.2 bits (139), Expect = 5e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -2 Query: 540 NRFRRNXXXXXIDLPTHYLEVNHKIKKAIMFYGPHIAHIPLHVSMKDLNL 391 ++F R I+LPTHY EVNH+ KKA++ YGP+I HIP + +KD NL Sbjct: 288 HQFTRKRRIKRIELPTHYSEVNHRTKKAVVSYGPNIGHIPHDIRLKDPNL 337