BLASTX nr result
ID: Mentha24_contig00015078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00015078 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40621.1| hypothetical protein MIMGU_mgv1a008340mg [Mimulus... 57 3e-06 gb|AAL77445.1|L78468_1 acyl-ACP thioesterase [Perilla frutescens] 55 8e-06 >gb|EYU40621.1| hypothetical protein MIMGU_mgv1a008340mg [Mimulus guttatus] Length = 377 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/30 (93%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = +2 Query: 2 QFLHLLRLSNDNSEINRGRTEWR-KKPAKR 88 QFLHLLRLSND SEINRGRTEWR KKPAKR Sbjct: 348 QFLHLLRLSNDGSEINRGRTEWRKKKPAKR 377 >gb|AAL77445.1|L78468_1 acyl-ACP thioesterase [Perilla frutescens] Length = 368 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +2 Query: 2 QFLHLLRLSNDNSEINRGRTEWRKKPAKR 88 QFLHLLR+S D SEINRGRTEWRKK AKR Sbjct: 340 QFLHLLRISTDGSEINRGRTEWRKKTAKR 368