BLASTX nr result
ID: Mentha24_contig00015011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00015011 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] 92 1e-16 gb|EYU27818.1| hypothetical protein MIMGU_mgv1a002017mg [Mimulus... 91 2e-16 ref|XP_006352605.1| PREDICTED: homeobox-leucine zipper protein M... 79 5e-13 ref|XP_004253429.1| PREDICTED: homeobox-leucine zipper protein M... 78 1e-12 ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein P... 78 1e-12 ref|XP_006343296.1| PREDICTED: homeobox-leucine zipper protein M... 77 3e-12 gb|EYU33907.1| hypothetical protein MIMGU_mgv1a001886mg [Mimulus... 76 6e-12 ref|XP_004248397.1| PREDICTED: homeobox-leucine zipper protein M... 75 1e-11 gb|EPS72090.1| hypothetical protein M569_02668, partial [Genlise... 72 8e-11 gb|EXB88451.1| Homeobox-leucine zipper protein MERISTEM L1 [Moru... 70 3e-10 ref|XP_007157166.1| hypothetical protein PHAVU_002G048200g [Phas... 57 2e-06 ref|XP_007026002.1| Protodermal factor 2 isoform 1 [Theobroma ca... 57 2e-06 >gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] Length = 712 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQPNMFDSHHHLL+MGHKTPEN++D+IRDDEYESKSGTDIME S Sbjct: 1 MFQPNMFDSHHHLLEMGHKTPENDLDIIRDDEYESKSGTDIMEAPS 46 >gb|EYU27818.1| hypothetical protein MIMGU_mgv1a002017mg [Mimulus guttatus] Length = 726 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/47 (91%), Positives = 44/47 (93%), Gaps = 1/47 (2%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGH-KTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQPNMFDSHHHLLDMGH KTPENEMDLIRDD+YESKSGTDIME S Sbjct: 1 MFQPNMFDSHHHLLDMGHNKTPENEMDLIRDDDYESKSGTDIMEAPS 47 >ref|XP_006352605.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Solanum tuberosum] gi|565372039|ref|XP_006352606.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X2 [Solanum tuberosum] Length = 712 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQ NMFDSH+ LLDM KTPENE+DLIRDDE+E+KSGTDIME AS Sbjct: 1 MFQHNMFDSHNFLLDMTRKTPENELDLIRDDEFETKSGTDIMEGAS 46 >ref|XP_004253429.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like, partial [Solanum lycopersicum] Length = 118 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/45 (77%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRD-DEYESKSGTDIMEN 323 MFQPNMF+SHHHLLDM HK+PEN++DL+RD DE+ESKS DIMEN Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENDLDLLRDNDEFESKSMADIMEN 45 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Vitis vinifera] gi|302144076|emb|CBI23181.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQPNMFDSHHHLLDM HKTPE+EM IRD+E+ESKSGT+ M+ S Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDEEFESKSGTENMDAPS 46 >ref|XP_006343296.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Solanum tuberosum] Length = 727 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/45 (75%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRD-DEYESKSGTDIMEN 323 MFQPN+F+SHHHLLDM HK+PEN++DL+RD DE+ESKS DIMEN Sbjct: 1 MFQPNIFESHHHLLDMSHKSPENDLDLLRDNDEFESKSMADIMEN 45 >gb|EYU33907.1| hypothetical protein MIMGU_mgv1a001886mg [Mimulus guttatus] Length = 744 Score = 75.9 bits (185), Expect = 6e-12 Identities = 40/49 (81%), Positives = 43/49 (87%), Gaps = 3/49 (6%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDM-GHKTPE-NEMD-LIRDDEYESKSGTDIMENAS 329 MFQPNMF+SHHHLL+M GHK PE NEMD LIRD+EYESKSGTDIME S Sbjct: 1 MFQPNMFESHHHLLEMAGHKPPENNEMDHLIRDEEYESKSGTDIMEPTS 49 >ref|XP_004248397.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Solanum lycopersicum] Length = 712 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQ NMFDSH+ LLDM KTPENE+DLIRDDE+E+KSG DIME + Sbjct: 1 MFQHNMFDSHNFLLDMTRKTPENELDLIRDDEFETKSGADIMEGGA 46 >gb|EPS72090.1| hypothetical protein M569_02668, partial [Genlisea aurea] Length = 728 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 4/50 (8%) Frame = +3 Query: 192 MFQPNMFDS---HHHLLDM-GHKTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQPNMFD HLL++ GHKTPENE+D IRDDEYESKSGTDIME S Sbjct: 1 MFQPNMFDGGGGSGHLLEISGHKTPENELDFIRDDEYESKSGTDIMEGNS 50 >gb|EXB88451.1| Homeobox-leucine zipper protein MERISTEM L1 [Morus notabilis] Length = 663 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMENAS 329 MFQPNMF++HHHLLDM HK+ ENE+ +RDD+ E+KSGT+ M+ S Sbjct: 1 MFQPNMFETHHHLLDMSHKSSENELGKVRDDDLETKSGTETMDAPS 46 >ref|XP_007157166.1| hypothetical protein PHAVU_002G048200g [Phaseolus vulgaris] gi|593788256|ref|XP_007157167.1| hypothetical protein PHAVU_002G048200g [Phaseolus vulgaris] gi|561030581|gb|ESW29160.1| hypothetical protein PHAVU_002G048200g [Phaseolus vulgaris] gi|561030582|gb|ESW29161.1| hypothetical protein PHAVU_002G048200g [Phaseolus vulgaris] Length = 727 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 3/49 (6%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMG-HKTPENEMDL--IRDDEYESKSGTDIMENAS 329 MF NMFDSH H+LDM HKT +E DL RDDEYE+KSGTD M+ S Sbjct: 1 MFHTNMFDSHPHMLDMSPHKTTFSETDLGRPRDDEYETKSGTDTMDAPS 49 >ref|XP_007026002.1| Protodermal factor 2 isoform 1 [Theobroma cacao] gi|590625865|ref|XP_007026003.1| Protodermal factor 2 isoform 1 [Theobroma cacao] gi|590625868|ref|XP_007026004.1| Protodermal factor 2 isoform 1 [Theobroma cacao] gi|508781368|gb|EOY28624.1| Protodermal factor 2 isoform 1 [Theobroma cacao] gi|508781369|gb|EOY28625.1| Protodermal factor 2 isoform 1 [Theobroma cacao] gi|508781370|gb|EOY28626.1| Protodermal factor 2 isoform 1 [Theobroma cacao] Length = 720 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 192 MFQPNMFDSHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIME 320 MF PN+FDS H + DM HKT E E+ IRDD+YE+KSGT+ M+ Sbjct: 1 MFSPNLFDSPH-MFDMTHKTSEGELGKIRDDDYETKSGTETMD 42